![Western Blot: RMND5A Antibody [NBP1-92337] - rmnd5 is expressed during early embryonic development. Rmnd5 protein at different developmental stages. Western blot analysis of embryo lysate from indicated stages (top). alpha-RMND5A (Novus Biological; rabbit, 1:1000); alpha-Tubulin (at, 1:2500). Image collected and cropped by CiteAb from the following publication (//dx.plos.org/10.1371/journal.pone.0120342), licensed under a CC-BY license.](http://images.novusbio.com/fullsize/RMND5A-Antibody-Western-Blot-NBP1-92337-img0009.jpg "Western Blot: RMND5A Antibody [NBP1-92337] - rmnd5 is expressed during early embryonic development. Rmnd5 protein at different developmental stages. Western blot analysis of embryo lysate from indicated stages (top). alpha-RMND5A (Novus Biological; rabbit, 1:1000); alpha-Tubulin (at, 1:2500). Image collected and cropped by CiteAb from the following publication (//dx.plos.org/10.1371/journal.pone.0120342), licensed under a CC-BY license.")
| Reactivity | Hu, Am, Mu, RtSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: FDSDISSVGIDGCWQADSQRLLNEVMVEHFFRQGMLDVAE |
| Predicted Species | Mouse (100%), Rat (100%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | RMND5A |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for RMND5A Antibody (NBP1-92337)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | RMND5A |
![Immunohistochemistry-Paraffin: RMND5A Antibody [NBP1-92337] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.](http://images.novusbio.com/fullsize/RMND5A-Antibody-Immunohistochemistry-Paraffin-NBP1-92337-img0002.jpg "Immunohistochemistry-Paraffin: RMND5A Antibody [NBP1-92337] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.")
![Western Blot: RMND5A Antibody [NBP1-92337] - rmnd5 is expressed during early embryonic development. Temporal RT-PCR analysis of rmnd5 expression (top panel); different developmental stages (NF-stages) indicated at the top. ODC1 functions as RNA input control (bottom). Image collected and cropped by CiteAb from the following publication (//dx.plos.org/10.1371/journal.pone.0120342), licensed under a CC-BY license.](http://images.novusbio.com/fullsize/RMND5A-Antibody-Western-Blot-NBP1-92337-img0008.jpg "Western Blot: RMND5A Antibody [NBP1-92337] - rmnd5 is expressed during early embryonic development. Temporal RT-PCR analysis of rmnd5 expression (top panel); different developmental stages (NF-stages) indicated at the top. ODC1 functions as RNA input control (bottom). Image collected and cropped by CiteAb from the following publication (//dx.plos.org/10.1371/journal.pone.0120342), licensed under a CC-BY license.")
![Western Blot: RMND5A Antibody [NBP1-92337] - Rmnd5 is part of an ubiquitin ligase complex. Glycerol step gradient of Xenopus laevis NF stage 36 embryo lysates. Molecular mass (MW) standard: albumin (67 kDa), fraction 1, 2; LDH (140 kDa), fraction 4; catalase (232 kDa), fraction 6,7. Western blot analysis with alpha-RMND5A (Rmnd5; upper panel) (1:1000) and alpha-ARMC8 (lower panel) (1:1000). Image collected and cropped by CiteAb from the following publication (//dx.plos.org/10.1371/journal.pone.0120342), licensed under a CC-BY license.](http://images.novusbio.com/fullsize/RMND5A-Antibody-Western-Blot-NBP1-92337-img0010.jpg "Western Blot: RMND5A Antibody [NBP1-92337] - Rmnd5 is part of an ubiquitin ligase complex. Glycerol step gradient of Xenopus laevis NF stage 36 embryo lysates. Molecular mass (MW) standard: albumin (67 kDa), fraction 1, 2; LDH (140 kDa), fraction 4; catalase (232 kDa), fraction 6,7. Western blot analysis with alpha-RMND5A (Rmnd5; upper panel) (1:1000) and alpha-ARMC8 (lower panel) (1:1000). Image collected and cropped by CiteAb from the following publication (//dx.plos.org/10.1371/journal.pone.0120342), licensed under a CC-BY license.")
![Western Blot: RMND5A Antibody [NBP1-92337] - V5-HA-tagged RanBP9 maintains its ability to interact with known members of the CTLH complex & Nucleolin. RanBP9 WT & TT immortalized Mouse Embryonic Fibroblasts (MEFs) were cultured in standard conditions & protein lysates were obtained. Resin conjugated with alpha HA antibodies was used to immunoprecipitate RanBP9-TT protein. IPed fractions & 5% of input were run on gels to generate 5 different membranes that were probed with the indicated antibodies by WB. Vinculin is used as loading control. Shown results are representative of two independent experiments (biological replicates). Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/32346083), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp1-92337_rabbit-polyclonal-rmnd5a-antibody-310202415291936.jpg "Western Blot: RMND5A Antibody [NBP1-92337] - V5-HA-tagged RanBP9 maintains its ability to interact with known members of the CTLH complex & Nucleolin. RanBP9 WT & TT immortalized Mouse Embryonic Fibroblasts (MEFs) were cultured in standard conditions & protein lysates were obtained. Resin conjugated with alpha HA antibodies was used to immunoprecipitate RanBP9-TT protein. IPed fractions & 5% of input were run on gels to generate 5 different membranes that were probed with the indicated antibodies by WB. Vinculin is used as loading control. Shown results are representative of two independent experiments (biological replicates). Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/32346083), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Western Blot: RMND5A Antibody [NBP1-92337] - RanBPM & TWA1 are essential for complex stability. Whole cell extracts prepared from control shRNA & RanBPM shRNA HEK293 cells (a), or from control (labelled as C), TWA1, RMND5A, MAEA, ARMC8 & muskelin HEK293 CRISPR knockout cells (b–f) were analyzed by Western blot with antibodies to CTLH complex members, as indicated. Vinculin was used as a loading control. Quantifications are shown below each blot & protein levels are shown relative to control cells set to 1 & normalized to Vinculin levels. Data represent averages from three separate experiments, with error bars indicating SD. *P < 0.05, **P < 0.01, ***P < 0.001, ****P < 0.0001. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/31285494), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp1-92337_rabbit-polyclonal-rmnd5a-antibody-310202415304235.jpg "Western Blot: RMND5A Antibody [NBP1-92337] - RanBPM & TWA1 are essential for complex stability. Whole cell extracts prepared from control shRNA & RanBPM shRNA HEK293 cells (a), or from control (labelled as C), TWA1, RMND5A, MAEA, ARMC8 & muskelin HEK293 CRISPR knockout cells (b–f) were analyzed by Western blot with antibodies to CTLH complex members, as indicated. Vinculin was used as a loading control. Quantifications are shown below each blot & protein levels are shown relative to control cells set to 1 & normalized to Vinculin levels. Data represent averages from three separate experiments, with error bars indicating SD. *P < 0.05, **P < 0.01, ***P < 0.001, ****P < 0.0001. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/31285494), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Western Blot: RMND5A Antibody [NBP1-92337] - RanBPM & TWA1 are essential for complex stability. Whole cell extracts prepared from control shRNA & RanBPM shRNA HEK293 cells (a), or from control (labelled as C), TWA1, RMND5A, MAEA, ARMC8 & muskelin HEK293 CRISPR knockout cells (b–f) were analyzed by Western blot with antibodies to CTLH complex members, as indicated. Vinculin was used as a loading control. Quantifications are shown below each blot & protein levels are shown relative to control cells set to 1 & normalized to Vinculin levels. Data represent averages from three separate experiments, with error bars indicating SD. *P < 0.05, **P < 0.01, ***P < 0.001, ****P < 0.0001. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/31285494), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp1-92337_rabbit-polyclonal-rmnd5a-antibody-310202415384112.jpg "Western Blot: RMND5A Antibody [NBP1-92337] - RanBPM & TWA1 are essential for complex stability. Whole cell extracts prepared from control shRNA & RanBPM shRNA HEK293 cells (a), or from control (labelled as C), TWA1, RMND5A, MAEA, ARMC8 & muskelin HEK293 CRISPR knockout cells (b–f) were analyzed by Western blot with antibodies to CTLH complex members, as indicated. Vinculin was used as a loading control. Quantifications are shown below each blot & protein levels are shown relative to control cells set to 1 & normalized to Vinculin levels. Data represent averages from three separate experiments, with error bars indicating SD. *P < 0.05, **P < 0.01, ***P < 0.001, ****P < 0.0001. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/31285494), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Western Blot: RMND5A Antibody [NBP1-92337] - The CTLH complex has E3 ligase activity. (a) RanBPM immunocomplexes have E3 ligase activity that is dependent on RMND5A. Whole cell extracts prepared from wild type (WT; lanes 3–4) or RMND5A KO (lane 5) HEK293 cells were subjected to immunoprecipitation with a RanBPM antibody or an IgG control, as indicated. Immunoprecipitates were resuspended in an ubiquitination assay master mix & E2 enzyme (UBE2D2) was added (+) or omitted (−), prior to incubation at 37 °C for 30 minutes. Reactions were run on SDS-PAGE gel & fluorescein-ubiquitin was imaged directly on the gel at 800 nm. Shown below is a Western blot analyzing RanBPM & RMND5A presence in the immunoprecipitates. Asterisk indicates a non-specific band. (b) MAEA is required for CTLH complex activity. RanBPM was immunoprecipated from control or MAEA KO HEK293 cells & ubiquitination reactions were carried out as described above. The presence of RanBPM & MAEA in the immunoprecipitates was analyzed by Western blot. Asterisk indicates a non-specific band. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/31285494), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp1-92337_rabbit-polyclonal-rmnd5a-antibody-310202416121959.jpg "Western Blot: RMND5A Antibody [NBP1-92337] - The CTLH complex has E3 ligase activity. (a) RanBPM immunocomplexes have E3 ligase activity that is dependent on RMND5A. Whole cell extracts prepared from wild type (WT; lanes 3–4) or RMND5A KO (lane 5) HEK293 cells were subjected to immunoprecipitation with a RanBPM antibody or an IgG control, as indicated. Immunoprecipitates were resuspended in an ubiquitination assay master mix & E2 enzyme (UBE2D2) was added (+) or omitted (−), prior to incubation at 37 °C for 30 minutes. Reactions were run on SDS-PAGE gel & fluorescein-ubiquitin was imaged directly on the gel at 800 nm. Shown below is a Western blot analyzing RanBPM & RMND5A presence in the immunoprecipitates. Asterisk indicates a non-specific band. (b) MAEA is required for CTLH complex activity. RanBPM was immunoprecipated from control or MAEA KO HEK293 cells & ubiquitination reactions were carried out as described above. The presence of RanBPM & MAEA in the immunoprecipitates was analyzed by Western blot. Asterisk indicates a non-specific band. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/31285494), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Western Blot: RMND5A Antibody [NBP1-92337] - Characterization of the CTLH complex. (a) Schematic representation of the CTLH complex. The model is adapted from the yeast Gid complex26. Note that the position of muskelin in the complex has not been formally defined. (b) Subunits of the CTLH complex are present in RanBPM immunocomplexes. HEK293 whole cell extracts were incubated with a RanBPM antibody & immunoprecipitated. Immunoprecipitates were analyzed by Western blot with the indicated antibodies. IgG was used as a negative control. (c) WDR26 associates with the CTLH complex. Whole cell extracts were prepared from HeLa cells untransfected (−) or transfected with FLAG-tagged WDR26 (+). FLAG-WDR26 was immunoprecipitated with a FLAG antibody & immunoprecipitates were analyzed by Western blot with the indicated antibodies. (d) GID4 associates with CTLH complex. Whole cell extracts were prepared from HEK293 cells untransfected (−) or transfected with HA tagged GID4 (+). HA-GID4 was immunoprecipitated with an HA antibody & immunoprecipitates were analyzed by Western blot with the indicated antibodies. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/31285494), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp1-92337_rabbit-polyclonal-rmnd5a-antibody-31020241611474.jpg "Western Blot: RMND5A Antibody [NBP1-92337] - Characterization of the CTLH complex. (a) Schematic representation of the CTLH complex. The model is adapted from the yeast Gid complex26. Note that the position of muskelin in the complex has not been formally defined. (b) Subunits of the CTLH complex are present in RanBPM immunocomplexes. HEK293 whole cell extracts were incubated with a RanBPM antibody & immunoprecipitated. Immunoprecipitates were analyzed by Western blot with the indicated antibodies. IgG was used as a negative control. (c) WDR26 associates with the CTLH complex. Whole cell extracts were prepared from HeLa cells untransfected (−) or transfected with FLAG-tagged WDR26 (+). FLAG-WDR26 was immunoprecipitated with a FLAG antibody & immunoprecipitates were analyzed by Western blot with the indicated antibodies. (d) GID4 associates with CTLH complex. Whole cell extracts were prepared from HEK293 cells untransfected (−) or transfected with HA tagged GID4 (+). HA-GID4 was immunoprecipitated with an HA antibody & immunoprecipitates were analyzed by Western blot with the indicated antibodies. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/31285494), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Western Blot: RMND5A Antibody [NBP1-92337] - C-Raf is regulated by the proteasome through the CTLH complex. Non-targeting shRNA control & shRNA RanBPM cells were treated with 10 μM MG132 or DMSO, as vehicle, for 24 h. RIPA buffered whole cell extracts of HeLa (A), & HCT116 (B) were analyzed by Western blot with RanBPM, c-Raf & beta -actin antibodies to detect RanBPM, c-Raf & beta -actin proteins, respectively. c-Raf protein levels were normalized to beta -actin levels. Quantifications of relative c-Raf protein levels are shown with error bars indicating SD (n = 4). * p < 0.05; ** p < 0.01; ns, no significance. (C) c-Raf is ubiquitinated in a CTLH complex-dependent manner. Hela control (WT Hela) & RMND5A KO cells were transfected with GST-delta N-c-Raf and/or HA-Ubiquitin as indicated. GST pull-downs performed using whole cell extracts were analyzed by Western blot with the indicated antibodies. Input represent 5% of the extracts used for pull-down. The asterix (*) indicates a non-specific band (NS). (D) A-Raf & B-Raf expression is increased in RMND5A KO cells. Extracts from HEK293 control & RMND5A CRISPR KO cells were analyzed by Western blot with the indicated antibodies. Quantifications are shown below with error bar indicating SD, n = 8 for A-Raf, **** p < 0.0001 & n = 3 for B-Raf, ** p < 0.01. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/30795516), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp1-92337_rabbit-polyclonal-rmnd5a-antibody-310202416114796.jpg "Western Blot: RMND5A Antibody [NBP1-92337] - C-Raf is regulated by the proteasome through the CTLH complex. Non-targeting shRNA control & shRNA RanBPM cells were treated with 10 μM MG132 or DMSO, as vehicle, for 24 h. RIPA buffered whole cell extracts of HeLa (A), & HCT116 (B) were analyzed by Western blot with RanBPM, c-Raf & beta -actin antibodies to detect RanBPM, c-Raf & beta -actin proteins, respectively. c-Raf protein levels were normalized to beta -actin levels. Quantifications of relative c-Raf protein levels are shown with error bars indicating SD (n = 4). * p < 0.05; ** p < 0.01; ns, no significance. (C) c-Raf is ubiquitinated in a CTLH complex-dependent manner. Hela control (WT Hela) & RMND5A KO cells were transfected with GST-delta N-c-Raf and/or HA-Ubiquitin as indicated. GST pull-downs performed using whole cell extracts were analyzed by Western blot with the indicated antibodies. Input represent 5% of the extracts used for pull-down. The asterix (*) indicates a non-specific band (NS). (D) A-Raf & B-Raf expression is increased in RMND5A KO cells. Extracts from HEK293 control & RMND5A CRISPR KO cells were analyzed by Western blot with the indicated antibodies. Quantifications are shown below with error bar indicating SD, n = 8 for A-Raf, **** p < 0.0001 & n = 3 for B-Raf, ** p < 0.01. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/30795516), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Western Blot: RMND5A Antibody [NBP1-92337] - Characterization of the CTLH complex. (a) Schematic representation of the CTLH complex. The model is adapted from the yeast Gid complex26. Note that the position of muskelin in the complex has not been formally defined. (b) Subunits of the CTLH complex are present in RanBPM immunocomplexes. HEK293 whole cell extracts were incubated with a RanBPM antibody & immunoprecipitated. Immunoprecipitates were analyzed by Western blot with the indicated antibodies. IgG was used as a negative control. (c) WDR26 associates with the CTLH complex. Whole cell extracts were prepared from HeLa cells untransfected (−) or transfected with FLAG-tagged WDR26 (+). FLAG-WDR26 was immunoprecipitated with a FLAG antibody & immunoprecipitates were analyzed by Western blot with the indicated antibodies. (d) GID4 associates with CTLH complex. Whole cell extracts were prepared from HEK293 cells untransfected (−) or transfected with HA tagged GID4 (+). HA-GID4 was immunoprecipitated with an HA antibody & immunoprecipitates were analyzed by Western blot with the indicated antibodies. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/31285494), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp1-92337_rabbit-polyclonal-rmnd5a-antibody-31020241612247.jpg "Western Blot: RMND5A Antibody [NBP1-92337] - Characterization of the CTLH complex. (a) Schematic representation of the CTLH complex. The model is adapted from the yeast Gid complex26. Note that the position of muskelin in the complex has not been formally defined. (b) Subunits of the CTLH complex are present in RanBPM immunocomplexes. HEK293 whole cell extracts were incubated with a RanBPM antibody & immunoprecipitated. Immunoprecipitates were analyzed by Western blot with the indicated antibodies. IgG was used as a negative control. (c) WDR26 associates with the CTLH complex. Whole cell extracts were prepared from HeLa cells untransfected (−) or transfected with FLAG-tagged WDR26 (+). FLAG-WDR26 was immunoprecipitated with a FLAG antibody & immunoprecipitates were analyzed by Western blot with the indicated antibodies. (d) GID4 associates with CTLH complex. Whole cell extracts were prepared from HEK293 cells untransfected (−) or transfected with HA tagged GID4 (+). HA-GID4 was immunoprecipitated with an HA antibody & immunoprecipitates were analyzed by Western blot with the indicated antibodies. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/31285494), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Western Blot: RMND5A Antibody [NBP1-92337] - The CTLH complex has E3 ligase activity. (a) RanBPM immunocomplexes have E3 ligase activity that is dependent on RMND5A. Whole cell extracts prepared from wild type (WT; lanes 3–4) or RMND5A KO (lane 5) HEK293 cells were subjected to immunoprecipitation with a RanBPM antibody or an IgG control, as indicated. Immunoprecipitates were resuspended in an ubiquitination assay master mix & E2 enzyme (UBE2D2) was added (+) or omitted (−), prior to incubation at 37 °C for 30 minutes. Reactions were run on SDS-PAGE gel & fluorescein-ubiquitin was imaged directly on the gel at 800 nm. Shown below is a Western blot analyzing RanBPM & RMND5A presence in the immunoprecipitates. Asterisk indicates a non-specific band. (b) MAEA is required for CTLH complex activity. RanBPM was immunoprecipated from control or MAEA KO HEK293 cells & ubiquitination reactions were carried out as described above. The presence of RanBPM & MAEA in the immunoprecipitates was analyzed by Western blot. Asterisk indicates a non-specific band. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/31285494), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp1-92337_rabbit-polyclonal-rmnd5a-antibody-31020241613616.jpg "Western Blot: RMND5A Antibody [NBP1-92337] - The CTLH complex has E3 ligase activity. (a) RanBPM immunocomplexes have E3 ligase activity that is dependent on RMND5A. Whole cell extracts prepared from wild type (WT; lanes 3–4) or RMND5A KO (lane 5) HEK293 cells were subjected to immunoprecipitation with a RanBPM antibody or an IgG control, as indicated. Immunoprecipitates were resuspended in an ubiquitination assay master mix & E2 enzyme (UBE2D2) was added (+) or omitted (−), prior to incubation at 37 °C for 30 minutes. Reactions were run on SDS-PAGE gel & fluorescein-ubiquitin was imaged directly on the gel at 800 nm. Shown below is a Western blot analyzing RanBPM & RMND5A presence in the immunoprecipitates. Asterisk indicates a non-specific band. (b) MAEA is required for CTLH complex activity. RanBPM was immunoprecipated from control or MAEA KO HEK293 cells & ubiquitination reactions were carried out as described above. The presence of RanBPM & MAEA in the immunoprecipitates was analyzed by Western blot. Asterisk indicates a non-specific band. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/31285494), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Western Blot: RMND5A Antibody [NBP1-92337] - C-Raf is regulated by the proteasome through the CTLH complex. Non-targeting shRNA control & shRNA RanBPM cells were treated with 10 μM MG132 or DMSO, as vehicle, for 24 h. RIPA buffered whole cell extracts of HeLa (A), & HCT116 (B) were analyzed by Western blot with RanBPM, c-Raf & beta -actin antibodies to detect RanBPM, c-Raf & beta -actin proteins, respectively. c-Raf protein levels were normalized to beta -actin levels. Quantifications of relative c-Raf protein levels are shown with error bars indicating SD (n = 4). * p < 0.05; ** p < 0.01; ns, no significance. (C) c-Raf is ubiquitinated in a CTLH complex-dependent manner. Hela control (WT Hela) & RMND5A KO cells were transfected with GST-delta N-c-Raf and/or HA-Ubiquitin as indicated. GST pull-downs performed using whole cell extracts were analyzed by Western blot with the indicated antibodies. Input represent 5% of the extracts used for pull-down. The asterix (*) indicates a non-specific band (NS). (D) A-Raf & B-Raf expression is increased in RMND5A KO cells. Extracts from HEK293 control & RMND5A CRISPR KO cells were analyzed by Western blot with the indicated antibodies. Quantifications are shown below with error bar indicating SD, n = 8 for A-Raf, **** p < 0.0001 & n = 3 for B-Raf, ** p < 0.01. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/30795516), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp1-92337_rabbit-polyclonal-rmnd5a-antibody-31020241613642.jpg "Western Blot: RMND5A Antibody [NBP1-92337] - C-Raf is regulated by the proteasome through the CTLH complex. Non-targeting shRNA control & shRNA RanBPM cells were treated with 10 μM MG132 or DMSO, as vehicle, for 24 h. RIPA buffered whole cell extracts of HeLa (A), & HCT116 (B) were analyzed by Western blot with RanBPM, c-Raf & beta -actin antibodies to detect RanBPM, c-Raf & beta -actin proteins, respectively. c-Raf protein levels were normalized to beta -actin levels. Quantifications of relative c-Raf protein levels are shown with error bars indicating SD (n = 4). * p < 0.05; ** p < 0.01; ns, no significance. (C) c-Raf is ubiquitinated in a CTLH complex-dependent manner. Hela control (WT Hela) & RMND5A KO cells were transfected with GST-delta N-c-Raf and/or HA-Ubiquitin as indicated. GST pull-downs performed using whole cell extracts were analyzed by Western blot with the indicated antibodies. Input represent 5% of the extracts used for pull-down. The asterix (*) indicates a non-specific band (NS). (D) A-Raf & B-Raf expression is increased in RMND5A KO cells. Extracts from HEK293 control & RMND5A CRISPR KO cells were analyzed by Western blot with the indicated antibodies. Quantifications are shown below with error bar indicating SD, n = 8 for A-Raf, **** p < 0.0001 & n = 3 for B-Raf, ** p < 0.01. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/30795516), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Western Blot: RMND5A Antibody [NBP1-92337] - Characterization of the CTLH complex. (a) Schematic representation of the CTLH complex. The model is adapted from the yeast Gid complex26. Note that the position of muskelin in the complex has not been formally defined. (b) Subunits of the CTLH complex are present in RanBPM immunocomplexes. HEK293 whole cell extracts were incubated with a RanBPM antibody & immunoprecipitated. Immunoprecipitates were analyzed by Western blot with the indicated antibodies. IgG was used as a negative control. (c) WDR26 associates with the CTLH complex. Whole cell extracts were prepared from HeLa cells untransfected (−) or transfected with FLAG-tagged WDR26 (+). FLAG-WDR26 was immunoprecipitated with a FLAG antibody & immunoprecipitates were analyzed by Western blot with the indicated antibodies. (d) GID4 associates with CTLH complex. Whole cell extracts were prepared from HEK293 cells untransfected (−) or transfected with HA tagged GID4 (+). HA-GID4 was immunoprecipitated with an HA antibody & immunoprecipitates were analyzed by Western blot with the indicated antibodies. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/31285494), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp1-92337_rabbit-polyclonal-rmnd5a-antibody-310202416121969.jpg "Western Blot: RMND5A Antibody [NBP1-92337] - Characterization of the CTLH complex. (a) Schematic representation of the CTLH complex. The model is adapted from the yeast Gid complex26. Note that the position of muskelin in the complex has not been formally defined. (b) Subunits of the CTLH complex are present in RanBPM immunocomplexes. HEK293 whole cell extracts were incubated with a RanBPM antibody & immunoprecipitated. Immunoprecipitates were analyzed by Western blot with the indicated antibodies. IgG was used as a negative control. (c) WDR26 associates with the CTLH complex. Whole cell extracts were prepared from HeLa cells untransfected (−) or transfected with FLAG-tagged WDR26 (+). FLAG-WDR26 was immunoprecipitated with a FLAG antibody & immunoprecipitates were analyzed by Western blot with the indicated antibodies. (d) GID4 associates with CTLH complex. Whole cell extracts were prepared from HEK293 cells untransfected (−) or transfected with HA tagged GID4 (+). HA-GID4 was immunoprecipitated with an HA antibody & immunoprecipitates were analyzed by Western blot with the indicated antibodies. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/31285494), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![SCF/c-kit Ligand [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "SCF/c-kit Ligand [Unconjugated]")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")