![Western Blot: RHCG Antibody [NBP2-30905] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue](http://images.novusbio.com/fullsize/RHCG-Antibody-Western-Blot-NBP2-30905-img0001.jpg "Western Blot: RHCG Antibody [NBP2-30905] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: RYDFEADAHWWSERTHKNLSDMENEFYYRYP |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | RHCG |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Neutralization CXCL8/IL-8 Antibody (6217) [Unconjugated]](https://images.novusbio.com/images2/CXCL8_MAB208_Block_Neutralize_9064.jpg)
![Immunocytochemistry CXCL8/IL-8 Antibody (6217) [Unconjugated]](https://images.novusbio.com/images2/CXCL8_MAB208_Immunocytochemistry_9339.jpg)
![Western Blot CXCL8/IL-8 Antibody (6217) [Unconjugated]](https://images.novusbio.com/images2/mab208_human-il-8-cxcl8-mab-clone-6217-western-blot-1882021143847.jpg)
| Publication using NBP2-30905 | Applications | Species |
|---|---|---|
| Su C, Lv Y, Lu W Et al. Single-Cell RNA Sequencing in Multiple Pathologic Types of Renal Cell Carcinoma Revealed Novel Potential Tumor-Specific Markers Frontiers in Oncology 2021-10-14 [PMID: 34722263] (IHC-P, Human) | IHC-P | Human |
Secondary Antibodies |
Isotype Controls |
Research Areas for RHCG Antibody (NBP2-30905)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: RHCG Antibody [NBP2-30905] - Staining of human Pancreas shows no membranous positivity in exocrine glandular cells as expected.](http://images.novusbio.com/fullsize/RHCG-Antibody-Immunohistochemistry-Paraffin-NBP2-30905-img0015.jpg "Immunohistochemistry-Paraffin: RHCG Antibody [NBP2-30905] - Staining of human Pancreas shows no membranous positivity in exocrine glandular cells as expected.")
![Immunohistochemistry-Paraffin: RHCG Antibody [NBP2-30905] - Staining of human rectum shows low expression as expected.](http://images.novusbio.com/fullsize/RHCG-Antibody-Immunohistochemistry-Paraffin-NBP2-30905-img0004.jpg "Immunohistochemistry-Paraffin: RHCG Antibody [NBP2-30905] - Staining of human rectum shows low expression as expected.")
![Immunohistochemistry-Paraffin: RHCG Antibody [NBP2-30905] - Staining of human colon, esophagus, kidney and lymph node using Anti-RHCG antibody NBP2-30905 (A) shows similar protein distribution across tissues to independent antibody NBP2-30825 (B).](http://images.novusbio.com/fullsize/RHCG-Antibody-Immunohistochemistry-Paraffin-NBP2-30905-img0006.jpg "Immunohistochemistry-Paraffin: RHCG Antibody [NBP2-30905] - Staining of human colon, esophagus, kidney and lymph node using Anti-RHCG antibody NBP2-30905 (A) shows similar protein distribution across tissues to independent antibody NBP2-30825 (B).")
![Immunohistochemistry-Paraffin: RHCG Antibody [NBP2-30905] - Staining of human lymph node.](http://images.novusbio.com/fullsize/RHCG-Antibody-Immunohistochemistry-Paraffin-NBP2-30905-img0007.jpg "Immunohistochemistry-Paraffin: RHCG Antibody [NBP2-30905] - Staining of human lymph node.")
![Immunohistochemistry-Paraffin: RHCG Antibody [NBP2-30905] - Staining of human kidney.](http://images.novusbio.com/fullsize/RHCG-Antibody-Immunohistochemistry-Paraffin-NBP2-30905-img0008.jpg "Immunohistochemistry-Paraffin: RHCG Antibody [NBP2-30905] - Staining of human kidney.")
![Immunohistochemistry-Paraffin: RHCG Antibody [NBP2-30905] - Staining of human colon.](http://images.novusbio.com/fullsize/RHCG-Antibody-Immunohistochemistry-Paraffin-NBP2-30905-img0009.jpg "Immunohistochemistry-Paraffin: RHCG Antibody [NBP2-30905] - Staining of human colon.")
![Immunohistochemistry-Paraffin: RHCG Antibody [NBP2-30905] - Analysis in human esophagus and pancreas tissues using NBP2-30905 antibody. Corresponding RHCG RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/RHCG-Antibody-Immunohistochemistry-Paraffin-NBP2-30905-img0010.jpg "Immunohistochemistry-Paraffin: RHCG Antibody [NBP2-30905] - Analysis in human esophagus and pancreas tissues using NBP2-30905 antibody. Corresponding RHCG RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: RHCG Antibody [NBP2-30905] - Staining of human Esophagus shows strong membranous positivity in squamous epithelial cells.](http://images.novusbio.com/fullsize/RHCG-Antibody-Immunohistochemistry-Paraffin-NBP2-30905-img0011.jpg "Immunohistochemistry-Paraffin: RHCG Antibody [NBP2-30905] - Staining of human Esophagus shows strong membranous positivity in squamous epithelial cells.")
![Immunohistochemistry-Paraffin: RHCG Antibody [NBP2-30905] - Staining of human kidney shows strong membranous positivity in cells in distal tubules.](http://images.novusbio.com/fullsize/RHCG-Antibody-Immunohistochemistry-Paraffin-NBP2-30905-img0012.jpg "Immunohistochemistry-Paraffin: RHCG Antibody [NBP2-30905] - Staining of human kidney shows strong membranous positivity in cells in distal tubules.")
![Immunohistochemistry-Paraffin: RHCG Antibody [NBP2-30905] - Staining of human kidney, lymph node, pancreas and squamous epithelia using Anti-RHCG antibody NBP2-30905 (A) shows similar protein distribution across tissues to independent antibody NBP2-30825 (B).](http://images.novusbio.com/fullsize/RHCG-Antibody-Immunohistochemistry-Paraffin-NBP2-30905-img0013.jpg "Immunohistochemistry-Paraffin: RHCG Antibody [NBP2-30905] - Staining of human kidney, lymph node, pancreas and squamous epithelia using Anti-RHCG antibody NBP2-30905 (A) shows similar protein distribution across tissues to independent antibody NBP2-30825 (B).")
![Immunohistochemistry-Paraffin: RHCG Antibody [NBP2-30905] - Staining of human Lymph node shows no membranous positivity in non-germinal center cells as expected.](http://images.novusbio.com/fullsize/RHCG-Antibody-Immunohistochemistry-Paraffin-NBP2-30905-img0014.jpg "Immunohistochemistry-Paraffin: RHCG Antibody [NBP2-30905] - Staining of human Lymph node shows no membranous positivity in non-germinal center cells as expected.")
![Immunohistochemistry-Paraffin: RHCG Antibody [NBP2-30905] - Staining of human Tonsil shows strong membranous positivity in squamous epithelial cells.](http://images.novusbio.com/fullsize/RHCG-Antibody-Immunohistochemistry-Paraffin-NBP2-30905-img0016.jpg "Immunohistochemistry-Paraffin: RHCG Antibody [NBP2-30905] - Staining of human Tonsil shows strong membranous positivity in squamous epithelial cells.")
![Western Blot Cathepsin L Antibody [Unconjugated]](https://images.novusbio.com/images2/Cathepsin_L_AF952_Western_Blot_20998.jpg)
![Immunohistochemistry Cathepsin L Antibody [Unconjugated]](https://images.novusbio.com/images2/Cathepsin_L_AF952_Immunohistochemistry_17794.jpg)
![Western Blot Cathepsin L Antibody [Unconjugated]](https://images.novusbio.com/images/af952_human-cathepsin-l-affinity-purified-polyclonal-ab-8220249511428.jpg)
![Immunohistochemistry Uteroglobin/SCGB1A1 Antibody (394324) [Unconjugated]](https://images.novusbio.com/images2/Uteroglobin_MAB4218_Immunohistochemistry_7019.jpg)
![Immunohistochemistry Uteroglobin/SCGB1A1 Antibody (394324) [Unconjugated]](https://images.novusbio.com/images2/Uteroglobin_MAB4218_Immunohistochemistry_9991.jpg)
![Immunocytochemistry RUNX2/CBFA1 Antibody (232902) [Unconjugated]](https://images.novusbio.com/images2/RUNX2_MAB2006_Immunocytochemistry_13309.jpg)
![Immunohistochemistry RUNX2/CBFA1 Antibody (232902) [Unconjugated]](https://images.novusbio.com/images/mab2006_human-runx2-cbfa1-mab-clone-232902-812025555286.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")