Home » Regucalcin » Regucalcin Proteins » Regucalcin Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

Regucalcin Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Regucalcin Protein (NBP1-80850PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Regucalcin Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RGN.

Source: E. coli

Amino Acid Sequence: ALYSLFPDHHVKKYFDQVDISNGLDWSLDHKIFYYIDSLSYSVDAFDYDLQTGQISNRRSVYKLEKEEQIPDGMC

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
RGN
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-80850.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Regucalcin Recombinant Protein Antigen

  • EC 3.1.1.17
  • gluconolactonase
  • GNL
  • RCsenescence marker protein-30
  • regucalcin (senescence marker protein-30)
  • Senescence marker protein 30
  • SMP-30
  • SMP30regucalcin

Background

Regucalcin is encoded by this gene is a highly conserved, calcium-binding protein, that is preferentially expressed in the liver and kidney. It may have an important role in calcium homeostasis. Studies in rat indicate that this protein may also play a role in aging, as it shows age-associated down-regulation. This gene is part of a gene cluster on chromosome Xp11.3-Xp11.23. Alternative splicing results in two transcript variants having different 5' UTRs, but encoding the same protein.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Cytosolic
Sulfotransferase 2B1/ ...
AF6174
Immunohistochemistry Cytosolic Sulfotransferase 2B1/SULT2B1 Antibody
Western Blot Cytosolic Sulfotransferase 2B1/SULT2B1 Antibody
(2 Publications)
Species: Hu
Applications: IHC, IP, WB
RB1 Antibody
(607121) [Unconjugate
MAB6495
Western Blot RB1 Antibody (607121) [Unconjugated]
Immunocytochemistry RB1 Antibody (607121) [Unconjugated]
Simple Western RB1 Antibody (607121) [Unconjugated]
(5 Publications)
Species: Hu
Applications: ICC, Simple Western, WB
ERMAP Antibody
[Unconjugated]
AF4928
Flow Cytometry ERMAP Antibody [Unconjugated]
Species: Hu
Applications: CyTOF-ready, Flow, WB
DYX1C1 Antibody
NBP1-68766
Immunohistochemistry-Paraffin DYX1C1 Antibody
Western Blot DYX1C1 Antibody
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, PEP-ELISA, WB
PEX7 Antibody
NBP1-57578
Western Blot PEX7 Antibody
(1 Publication)
Species: Hu
Applications: WB
PHYH Antibody
NBP1-87349
Western Blot PHYH Antibody
Western Blot PHYH Antibody
Immunohistochemistry-Paraffin PHYH Antibody
Species: Hu, Mu
Applications: IHC, IHC-P, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(818 Publications)
Species: Hu
Applications: BA
Calmodulin 3
Antibody
NBP2-15669
Western Blot Calmodulin 3 Antibody
Western Blot Calmodulin 3 Antibody
Immunohistochemistry Whole-Mount Calmodulin 3 Antibody
(1 Publication)
Species: Mu, Rt, Ze
Applications: IHC-WhMt, IHC, WB
Calmodulin 2
Antibody
NBP2-14871
Immunocytochemistry/ Immunofluorescence Calmodulin 2 Antibody
Western Blot Calmodulin 2 Antibody
(1 Publication)
Species: Mu, Rt
Applications: ICC/IF, WB
Calmodulin
Antibody (2D1) - BSA
NB120-2860
Immunocytochemistry/ Immunofluorescence Calmodulin Antibody (2D1) - BSA Free
Immunocytochemistry/ Immunofluorescence Calmodulin Antibody (2D1) - BSA Free
Immunocytochemistry/ Immunofluorescence Calmodulin Antibody (2D1) - BSA Free
(3 Publications)
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
LIGHT/TNFSF14
[Unconjugated]
664-LI
SDS-PAGE LIGHT/TNFSF14 [Unconjugated]
Bioactivity LIGHT/TNFSF14 [Unconjugated]
(21 Publications)
Species: Hu
Applications: BA
p130 Antibody
NBP1-82455
Immunohistochemistry-Paraffin p130 Antibody
Immunohistochemistry-Paraffin p130 Antibody
Immunohistochemistry-Paraffin p130 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
PLOD1 Antibody
NBP2-38770
Western Blot PLOD1 Antibody
Western Blot PLOD1 Antibody
(3 Publications)
Species: Hu, Mu
Applications: IHC-P, WB
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Immunocytochemistry Insulin Antibody (182410) [Unconjugated]
Immunohistochemistry Insulin Antibody (182410) [Unconjugated]
(24 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
PTH Antibody
(918462) [Unconjugate
MAB7665
Immunohistochemistry PTH Antibody (918462) [Unconjugated]
Western Blot PTH Antibody (918462) [Unconjugated]
Species: Hu
Applications: IHC, WB
Cytochrome c
Antibody (7H8.2C12) - ...
NB100-56503
Flow Cytometry Cytochrome c Antibody (7H8.2C12) - BSA Free
Flow (Intracellular) Cytochrome c Antibody (7H8.2C12) - BSA Free
Western Blot Cytochrome c Antibody (7H8.2C12) - BSA Free
(61 Publications)
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-P, Simple Western, WB
Albumin Antibody
(188835) [Unconjugate ...
MAB1455
Simple Western Albumin Antibody (188835) [Unconjugated] - Serum
Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum
Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum
(3 Reviews)
(54 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Complement
Component C2 Antibody ...
AF1936
Complement Component C2 Antibody [Unconjugated]
(1 Publication)
Species: Hu
Applications: IP, WB

Publications for Regucalcin Protein (NBP1-80850PEP) (0)

There are no publications for Regucalcin Protein (NBP1-80850PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Regucalcin Protein (NBP1-80850PEP) (0)

There are no reviews for Regucalcin Protein (NBP1-80850PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Regucalcin Protein (NBP1-80850PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Regucalcin Products

Research Areas for Regucalcin Protein (NBP1-80850PEP)

Find related products by research area.

Blogs on Regucalcin

There are no specific blogs for Regucalcin, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Regucalcin Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol RGN