Home » REC8 » REC8 Proteins » REC8 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

REC8 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for REC8 Protein (NBP1-87145PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

REC8 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human REC8.

Source: E. coli

Amino Acid Sequence: PSPFDIPQIRHLLEAAIPERVEEIPPEVPTEPREPERIPVTVLPPEAITILEAEPIRMLEIEGERELPEVSRRELDLLI

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
REC8
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87145.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for REC8 Recombinant Protein Antigen

  • Cohesin Rec8p
  • cohesion rec8p
  • HR21spB
  • meiotic recombination and sister chromatid cohesion phosphoprotein of therad21p family
  • meiotic recombination protein REC8 homolog
  • meiotic recombination protein REC8-like 1
  • MGC950
  • REC8 homolog (yeast)
  • REC8L1human homolog of rad21, S. pombe
  • REC8-like 1 (yeast)
  • REC8-like 1
  • Rec8p
  • recombination and sister chromatid cohesion protein homolog

Background

REC8 encodes a member of the kleisin family of SMC (structural maintenance of chromosome) protein partners. The protein localizes to the axial elements of chromosomes during meiosis in both oocytes and spermatocytes. In the mouse, the homologous protein is a key component of the meiotic cohesion complex, which regulates sister chromatid cohesion and recombination between homologous chromosomes. Multiple alternatively spliced variants, encoding the same protein, have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Rad21 Antibody
NBP2-20053
Immunohistochemistry-Paraffin Rad21 Antibody
Immunohistochemistry-Paraffin Rad21 Antibody
Immunocytochemistry/ Immunofluorescence Rad21 Antibody
(1 Review)
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, WB
Separase Antibody
(6H6)
H00009700-M01
Western Blot Separase Antibody (6H6)
Immunohistochemistry-Paraffin Separase Antibody (6H6)
(14 Publications)
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
SMC3 Antibody
NB100-207
Unknown SMC3 Antibody
Western Blot SMC3 Antibody
Immunohistochemistry-Paraffin SMC3 Antibody
(9 Publications)
Species: Ce, Hu, Mu
Applications: IHC, IHC-P, IP, WB
DEP-1/CD148
Antibody (143-41)
MAB1934
Western Blot DEP-1/CD148 Antibody (143-41)
(2 Reviews)
(5 Publications)
Species: Hu
Applications: CyTOF-ready, Flow, IP, WB
SPO11 Antibody
NBP1-58172
Western Blot SPO11 Antibody
Western Blot SPO11 Antibody
(1 Publication)
Species: Hu, Mu
Applications: WB
SCP3/SYCP3
Antibody - BSA Free
NB300-232
Western Blot SCP3/SYCP3 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence SCP3/SYCP3 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence SCP3/SYCP3 Antibody - BSA Free
(2 Reviews)
(82 Publications)
Species: Bv, Ch, Fe, Hu, Mu, Pa, Po, Rt
Applications: IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
ERMAP Antibody
[Unconjugated]
AF4928
Flow Cytometry ERMAP Antibody [Unconjugated]
Species: Hu
Applications: CyTOF-ready, Flow, WB
STAG3 Antibody
NBP2-38851
Immunohistochemistry-Paraffin STAG3 Antibody
Immunohistochemistry-Paraffin STAG3 Antibody
Immunohistochemistry-Paraffin STAG3 Antibody
Species: Hu
Applications: IHC, IHC-P
SMC1 Antibody
NB100-204
Immunohistochemistry-Paraffin SMC1 Antibody
Immunohistochemistry-Paraffin SMC1 Antibody
Unknown SMC1 Antibody
(36 Publications)
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
SMC1L2 Antibody
NBP1-89966
Immunocytochemistry/ Immunofluorescence SMC1L2 Antibody
Immunohistochemistry-Paraffin SMC1L2 Antibody
Immunohistochemistry-Paraffin SMC1L2 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P
DMC1 Antibody
(1D12/4)
NB100-181
Western Blot DMC1 Antibody (1D12/4)
(1 Review)
(1 Publication)
Species: Hu, Mu
Applications: IP, WB
PTTG1 Antibody
NBP2-20287
Western Blot PTTG1 Antibody
Immunocytochemistry/ Immunofluorescence PTTG1 Antibody
Immunoprecipitation PTTG1 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
HID1 Antibody
(OTI2F4)
NBP2-02667
Western Blot HID1 Antibody (OTI2F4)
Flow Cytometry HID1 Antibody (OTI2F4)
Flow Cytometry HID1 Antibody (OTI2F4)
(3 Publications)
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
SGOL2 Antibody
NB100-60454
Immunoprecipitation SGOL2 Antibody
(2 Publications)
Species: Hu
Applications: IP, WB (-)
Rad51 Antibody
(14B4)
NB100-148
Western Blot Rad51 Antibody (14B4)
Western Blot Rad51 Antibody (14B4)
Western Blot Rad51 Antibody (14B4)
(5 Reviews)
(66 Publications)
Species: Ch, Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, KD, PLA, WB
Coagulation Factor
XIV/Protein C Antibod ...
AF4885
Coagulation Factor XIV/Protein C Antibody
(2 Publications)
Species: Mu
Applications: IP, WB
APC Antibody - BSA
Free
NB100-91662
Immunocytochemistry/ Immunofluorescence APC Antibody - BSA Free
Flow Cytometry APC Antibody - BSA Free
Immunohistochemistry-Paraffin APC Antibody - BSA Free
(2 Publications)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
SCC112 Antibody
NBP1-87904
Immunocytochemistry/ Immunofluorescence SCC112 Antibody
Western Blot SCC112 Antibody
Immunohistochemistry-Paraffin SCC112 Antibody
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB

Publications for REC8 Protein (NBP1-87145PEP) (0)

There are no publications for REC8 Protein (NBP1-87145PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for REC8 Protein (NBP1-87145PEP) (0)

There are no reviews for REC8 Protein (NBP1-87145PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for REC8 Protein (NBP1-87145PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional REC8 Products

Research Areas for REC8 Protein (NBP1-87145PEP)

Find related products by research area.

Blogs on REC8

There are no specific blogs for REC8, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Western Blot: SCP3/SYCP3 Antibody [NB300-232] - SCP3 Antibody [NB300-232] - Analysis of SCP3 in mouse testis protein.
SCP3/SYCP3 Antibody - BSA Free
NB300-232
Western Blot: Rad51 Antibody (14B4) [NB100-148] - Various whole cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with Rad51 antibody [14B4] diluted at 1:500. The HRP-conjugated anti-mouset IgG antibody (NBP2-19382) was used to detect the primary antibody, and the signal was developed with Trident ECL plus-Enhanced.
Rad51 Antibody (14B4)
NB100-148

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our REC8 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol REC8