![Western Blot: RBP2 Antibody (3G12) [H00005948-M02] - Analysis of RBP2 expression in transfected 293T cell line by RBP2 monoclonal antibody (M02), clone 3G12.Lane 1: RBP2 transfected lysate (Predicted MW: 15.7 KDa).Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/RBP2-Antibody-3G12-Western-Blot-H00005948-M02-img0002.jpg "Western Blot: RBP2 Antibody (3G12) [H00005948-M02] - Analysis of RBP2 expression in transfected 293T cell line by RBP2 monoclonal antibody (M02), clone 3G12.Lane 1: RBP2 transfected lysate (Predicted MW: 15.7 KDa).Lane 2: Non-transfected lysate.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA |
| Clone | 3G12 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Description | Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen | RBP2 (NP_004155.2, 45 a.a. ~ 134 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QDGDNFKTKTTSTFRNYDVDFTVGVEFDEYTKSLDNRHVKALVTWEGDVLVCVQKGEKENRGWKQWIEGDKLYLELTCGDQVCRQVFKKK |
| Specificity | RBP2 - retinol binding protein 2, cellular (3G12) |
| Isotype | IgG2a Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | RBP2 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for RBP2 Antibody (H00005948-M02)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Western Blot: RBP2 Antibody (3G12) [H00005948-M02] - Western Blot detection against Immunogen (36.01 KDa) .](http://images.novusbio.com/fullsize/RBP2-Antibody-3G12-Western-Blot-H00005948-M02-img0001.jpg "Western Blot: RBP2 Antibody (3G12) [H00005948-M02] - Western Blot detection against Immunogen (36.01 KDa) .")
![Immunohistochemistry FABP7/B-FABP Antibody [Unconjugated]](https://images.novusbio.com/images2/FABP7_AF3166_Immunohistochemistry_6776.jpg)
![Simple Western FABP7/B-FABP Antibody [Unconjugated]](https://images.novusbio.com/images2/FABP7_AF3166_Simple_Western_18665.jpg)
