![Immunohistochemistry-Paraffin: RBM3 Antibody (CL0296) [NBP2-52906] - Staining in human tonsil and liver tissues. Corresponding RBM3 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/RBM3-Antibody-CL0296-Immunohistochemistry-Paraffin-NBP2-52906-img0014.jpg "Immunohistochemistry-Paraffin: RBM3 Antibody (CL0296) [NBP2-52906] - Staining in human tonsil and liver tissues. Corresponding RBM3 RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC, KD |
| Clone | CL0296 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: DEQALEDHFSSFGPISEVVVVKDRETQRSRGFGFITFTNPEHASVAMRAMNGESLDGRQIRVDHAGKSARGTRGGGFGAHGRGRSYSRGGGDQGYGSGRYYDSRPGGYGYGYGRSRDYNGRNQGGYDRYSGGNY |
| Predicted Species | Mouse (94%), Rat (96%). Backed by our 100% Guarantee. |
| Isotype | IgG1 |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | RBM3 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Protein A purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | RBM3 |
![Western Blot: RBM3 Antibody (CL0296) [NBP2-52906] - Analysis of extracts from U-251 cells, transfected with: control siRNA, target specific siRNA probe #1, target specific siRNA probe #2, using Anti-RBM3 monoclonal antibody. Downregulation of antibody signal confirms target specificity. Remaining % intensity, relative control lane, is indicated. Anti-GAPDH monoclonal antibody was used as loading control.](http://images.novusbio.com/fullsize/RBM3-Antibody-CL0296-Western-Blot-NBP2-52906-img0007.jpg "Western Blot: RBM3 Antibody (CL0296) [NBP2-52906] - Analysis of extracts from U-251 cells, transfected with: control siRNA, target specific siRNA probe #1, target specific siRNA probe #2, using Anti-RBM3 monoclonal antibody. Downregulation of antibody signal confirms target specificity. Remaining % intensity, relative control lane, is indicated. Anti-GAPDH monoclonal antibody was used as loading control.")
![Immunocytochemistry/Immunofluorescence: RBM3 Antibody (CL0296) [NBP2-52906] - Staining of U-2 OS cells using the anti-RBM3 monoclonal antibody, showing specific staining in the nucleoplasm in green. Microtubule- and nuclear probes are visualized in red and blue, respectively (where available). Antibody staining is shown in green.](http://images.novusbio.com/fullsize/RBM3-Antibody-CL0296-Immunocytochemistry-Immunofluorescence-NBP2-52906-img0006.jpg "Immunocytochemistry/Immunofluorescence: RBM3 Antibody (CL0296) [NBP2-52906] - Staining of U-2 OS cells using the anti-RBM3 monoclonal antibody, showing specific staining in the nucleoplasm in green. Microtubule- and nuclear probes are visualized in red and blue, respectively (where available). Antibody staining is shown in green.")
![Western Blot: RBM3 Antibody (CL0296) [NBP2-52906] - Lane 1: Marker [kDa], Lane 2: Human cell line RT-4](http://images.novusbio.com/fullsize/RBM3-Antibody-CL0296-Western-Blot-NBP2-52906-img0004.jpg "Western Blot: RBM3 Antibody (CL0296) [NBP2-52906] - Lane 1: Marker [kDa], Lane 2: Human cell line RT-4")
![Immunohistochemistry-Paraffin: RBM3 Antibody (CL0296) [NBP2-52906] - Staining of human tonsil shows moderate nuclear positivity in lymphoid cells, mainly in germinal centra.](http://images.novusbio.com/fullsize/RBM3-Antibody-CL0296-Immunohistochemistry-Paraffin-NBP2-52906-img0009.jpg "Immunohistochemistry-Paraffin: RBM3 Antibody (CL0296) [NBP2-52906] - Staining of human tonsil shows moderate nuclear positivity in lymphoid cells, mainly in germinal centra.")
![Immunohistochemistry-Paraffin: RBM3 Antibody (CL0296) [NBP2-52906] - Staining of human rectum shows moderate nuclear positivity in glandular cells.](http://images.novusbio.com/fullsize/RBM3-Antibody-CL0296-Immunohistochemistry-Paraffin-NBP2-52906-img0010.jpg "Immunohistochemistry-Paraffin: RBM3 Antibody (CL0296) [NBP2-52906] - Staining of human rectum shows moderate nuclear positivity in glandular cells.")
![Immunohistochemistry-Paraffin: RBM3 Antibody (CL0296) [NBP2-52906] - Staining of human breast cancer shows moderate nuclear positivity in tumor cells.](http://images.novusbio.com/fullsize/RBM3-Antibody-CL0296-Immunohistochemistry-Paraffin-NBP2-52906-img0011.jpg "Immunohistochemistry-Paraffin: RBM3 Antibody (CL0296) [NBP2-52906] - Staining of human breast cancer shows moderate nuclear positivity in tumor cells.")
![Immunohistochemistry-Paraffin: RBM3 Antibody (CL0296) [NBP2-52906] - Staining of human colorectal cancer shows weak to moderate nuclear positivity in a subset of tumor cells.](http://images.novusbio.com/fullsize/RBM3-Antibody-CL0296-Immunohistochemistry-Paraffin-NBP2-52906-img0012.jpg "Immunohistochemistry-Paraffin: RBM3 Antibody (CL0296) [NBP2-52906] - Staining of human colorectal cancer shows weak to moderate nuclear positivity in a subset of tumor cells.")
![Immunohistochemistry-Paraffin: RBM3 Antibody (CL0296) [NBP2-52906] - Staining of human liver shows no positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize/RBM3-Antibody-CL0296-Immunohistochemistry-Paraffin-NBP2-52906-img0013.jpg "Immunohistochemistry-Paraffin: RBM3 Antibody (CL0296) [NBP2-52906] - Staining of human liver shows no positivity in hepatocytes as expected.")
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_871.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_872.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/VEGF_DVE00_ELISA_208.jpg)
![SDS-Page: Mouse IgG1 Isotype Control (MG1) [NBP1-97005] - Lane 1: , Non-reduced. M: Opal Pre-stained Ladder. Lane 2: , Reduced. Load: 1.0 ug per lane. Predicted/Observed: 120 kDa Non-reduced, 55 and 25 Reduced.](https://images.novusbio.com/images/Mouse-IgG1-Isotype-Control-MG1-SDS-Page-NBP1-97005-img0002.jpg "SDS-Page: Mouse IgG1 Isotype Control (MG1) [NBP1-97005] - Lane 1: , Non-reduced. M: Opal Pre-stained Ladder. Lane 2: , Reduced. Load: 1.0 ug per lane. Predicted/Observed: 120 kDa Non-reduced, 55 and 25 Reduced.")