![Western Blot: PSMD6 Antibody [H00009861-B01P] - Analysis of PSMD6 expression in human placenta.](http://images.novusbio.com/fullsize/PSMD6-Antibody-Western-Blot-H00009861-B01P-img0001.jpg "Western Blot: PSMD6 Antibody [H00009861-B01P] - Analysis of PSMD6 expression in human placenta.")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | PSMD6 (NP_055629.1, 1 a.a. - 389 a.a.) full-length human protein. MPLENLEEEGLPKNPDLRIAQLRFLLSLPEHRGDAAVRDELMAAVRDNNMAPYYEALCKSLDWQIDVDLLNKMKKANEDELKRLDEELEDAEKNLGESEIRDAMMAKAEYLCRIGDKEGALTAFRKTYDKTVALGHRLDIVFYLLRIGLFYMDNDLITRNTEKAKSLIEEGGDWDRRNRLKVYQGLYCVAIRDFKQAAELFLDTVSTFTSYELMDYKTFVTYTVYVSMIALERPDLREKVIKGAEILEVLHSLPAVRQYLFSLYECRYSVFFQSLAVVEQEMKKDWLFAPHYRYYVREMRIHAYSQLLESYRSLTLGYMAEAFGVGVEFIDQELSRFIAAGRLHCKIDKVNEIVETNRPDSKNWQYQETIKKGDLLLNRVQKLSRVINM |
| Specificity | This product is specific for Human PSMD6 purified MaxPab mouse polyclonal antibody (B01P) [Gene ID: 9861]. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Mouse |
| Gene | PSMD6 |
| Purity | Protein G purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Mouse polyclonal antibody raised against a full-length human PSMD6 protein. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | Protein G purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | PSMD6 |
| Uniprot |
|
![Western Blot: PSMD6 Antibody [H00009861-B01P] - Analysis of PSMD6 expression in transfected 293T cell line by PSMD6 polyclonal antibody. Lane 1: PSMD6 transfected lysate(42.79 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/PSMD6-Antibody-Western-Blot-H00009861-B01P-img0002.jpg "Western Blot: PSMD6 Antibody [H00009861-B01P] - Analysis of PSMD6 expression in transfected 293T cell line by PSMD6 polyclonal antibody. Lane 1: PSMD6 transfected lysate(42.79 KDa). Lane 2: Non-transfected lysate.")
![Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]](https://images.novusbio.com/images/Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP1-97019-img0004.jpg "Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]")