Novus Biologicals products are now on bio-techne.com

Protein Kinase A regulatory subunit I alpha Recombinant Protein Antigen

Images

 
There are currently no images for Protein Kinase A regulatory subunit I alpha Recombinant Protein Antigen (NBP2-33585PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Protein Kinase A regulatory subunit I alpha Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PRKAR1A.

Source: E. coli

Amino Acid Sequence: MAFLREYFERLEKEEAKQIQNLQKAGTRTDSREDEISPPPP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PRKAR1A
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-33585.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.

Theoretical MW
22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Protein Kinase A regulatory subunit I alpha Recombinant Protein Antigen

  • cAMP-dependent protein kinase regulatory subunit RIalpha
  • cAMP-dependent protein kinase type I-alpha regulatory chain
  • cAMP-dependent protein kinase type I-alpha regulatory subunit
  • CAR
  • CNC
  • CNC1
  • MGC17251
  • PKA R1 alpha
  • PKA1
  • PKR1
  • PPNAD1
  • PRKAR1
  • PRKAR1A
  • Protein Kinase A regulatory subunit I alpha
  • protein kinase A type 1a regulatory subunit
  • protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specificextinguisher 1)
  • Tissue-specific extinguisher 1
  • TSE1
  • TSE1DKFZp779L0468

Background

cAMP is a signaling molecule important for a variety of cellular functions. cAMP exerts its effects by activating the cAMP-dependent protein kinase, which transduces the signal through phosphorylation of different target proteins. The inactive kinase holoenzyme is a tetramer composed of two regulatory and two catalytic subunits. cAMP causes the dissociation of the inactive holoenzyme into a dimer of regulatory subunits bound to four cAMP and two free monomeric catalytic subunits. Four different regulatory subunits and three catalytic subunits have been identified in humans. This gene encodes one of the regulatory subunits. This protein was found to be a tissue-specific extinguisher that down-regulates the expression of seven liver genes in hepatoma x fibroblast hybrids. Mutations in this gene cause Carney complex (CNC). This gene can fuse to the RET protooncogene by gene rearrangement and form the thyroid tumor-specific chimeric oncogene known as PTC2. A nonconventional nuclear localization sequence (NLS) has been found for this protein which suggests a role in DNA replication via the protein serving as a nuclear transport protein for the second subunit of the Replication Factor C (RFC40). Three alternatively spliced transcript variants encoding the same protein have been observed.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

PP-H4417-00
Species: Hu
Applications: DirELISA, IP, WB
PP-N4111-00
Species: Hu
Applications: IHC, IP, WB
AF7356
Species: Hu, Mu
Applications: CyTOF-ready, Flow, WB
NBP2-37502
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
AF2654
Species: Mu
Applications: IHC, Simple Western, WB
NBP2-01800
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB100-128
Species: Hu, Mu, Rt
Applications: ChIP, GS, ICC/IF, IHC, IHC-P, WB
NB300-537
Species: Bv, Hu, Mu, Rb, Rt
Applications: ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, KD, WB
PP-A9033A-00
Species: Hu
Applications: DirELISA, IHC, IP, WB
AF1107
Species: Mu
Applications: IHC, WB
H00003347-M01
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
H00001556-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NB300-731
Species: Gp, Hu, Mu, Rb, Rt, Sh, Ye
Applications: B/N, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, WB
H00005957-M37
Species: Hu
Applications: ELISA, ICC/IF, WB
AF2005
Species: Hu
Applications: CyTOF-ready, Flow, IHC, WB

Publications for Protein Kinase A regulatory subunit I alpha Recombinant Protein Antigen (NBP2-33585PEP) (0)

There are no publications for Protein Kinase A regulatory subunit I alpha Recombinant Protein Antigen (NBP2-33585PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Protein Kinase A regulatory subunit I alpha Recombinant Protein Antigen (NBP2-33585PEP) (0)

There are no reviews for Protein Kinase A regulatory subunit I alpha Recombinant Protein Antigen (NBP2-33585PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Protein Kinase A regulatory subunit I alpha Recombinant Protein Antigen (NBP2-33585PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Protein Kinase A regulatory subunit I alpha Products

Research Areas for Protein Kinase A regulatory subunit I alpha Recombinant Protein Antigen (NBP2-33585PEP)

Find related products by research area.

Blogs on Protein Kinase A regulatory subunit I alpha

There are no specific blogs for Protein Kinase A regulatory subunit I alpha, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Protein Kinase A regulatory subunit I alpha Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PRKAR1A