![Western Blot: Profilin 1 Antibody (CL3524) [NBP2-59778] - Profilin 1 Antibody (5216) [NBP2-59778] - Analysis of extracts from U-251 cells, transfected with: control siRNA, target specific siRNA probe #1, target specific siRNA probe #2, using Anti-PFN1 monoclonal antibody. Downregulation of antibody signal confirms target specificity. Remaining % intensity, relative control lane, is indicated. Anti-GAPDH monoclonal antibody was used as loading control.](http://images.novusbio.com/fullsize/Profilin-1-Antibody-5216-Immunohistochemistry-Paraffin-NBP2-59778-img0007.jpg "Western Blot: Profilin 1 Antibody (CL3524) [NBP2-59778] - Profilin 1 Antibody (5216) [NBP2-59778] - Analysis of extracts from U-251 cells, transfected with: control siRNA, target specific siRNA probe #1, target specific siRNA probe #2, using Anti-PFN1 monoclonal antibody. Downregulation of antibody signal confirms target specificity. Remaining % intensity, relative control lane, is indicated. Anti-GAPDH monoclonal antibody was used as loading control.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC, KD, KO |
| Clone | CL3524 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: KSIGGAPTFNVTVTKTDKTLVLLMGKEGIHG |
| Isotype | IgG2a |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | PFN1 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Protein A purified |
![Immunohistochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunohistochemistry_20892.jpg)
![Immunocytochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunocytochemistry__Immunofluorescence_21143.jpg)
![Western Blot EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Western_Blot_19925.jpg)
![Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Western_Blot_5930.jpg)
![Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/16332.jpg)
![Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Flow_Cytometry_8283.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for Profilin 1 Antibody (NBP2-59778)Find related products by research area.
|
|
Profiling the Profilin 1 Antibody Profilin-1, or Pfn-1, is a small actin-binding protein which plays an essential role controlling the growth of microfilaments. Profilin 1 and Profilin 2 have similar biochemical properties but are expressed in different tissues. The Profilin 1 antibod... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | PFN1 |
![Immunohistochemistry-Paraffin: Profilin 1 Antibody (5216) [NBP2-59778] - Staining of human testis shows weak immunoreactivity in basal cells of the seminiferous ducts.](http://images.novusbio.com/fullsize/Profilin-1-Antibody-5216-Immunohistochemistry-Paraffin-NBP2-59778-img0005.jpg "Immunohistochemistry-Paraffin: Profilin 1 Antibody (5216) [NBP2-59778] - Staining of human testis shows weak immunoreactivity in basal cells of the seminiferous ducts.")
![Western Blot: Profilin 1 Antibody (5216) [NBP2-59778] - Analysis in human cell line HeLa, human cell line HEK 293, human cell line A-431 and human cell line HepG2.](http://images.novusbio.com/fullsize/Profilin-1-Antibody-5216-Western-Blot-NBP2-59778-img0006.jpg "Western Blot: Profilin 1 Antibody (5216) [NBP2-59778] - Analysis in human cell line HeLa, human cell line HEK 293, human cell line A-431 and human cell line HepG2.")
![Immunohistochemistry-Paraffin: Profilin 1 Antibody (5216) [NBP2-59778] - Staining of human fallopian tube shows cytoplasmic immunoreactivity in epithelial cells.](http://images.novusbio.com/fullsize/Profilin-1-Antibody-5216-Immunohistochemistry-Paraffin-NBP2-59778-img0001.jpg "Immunohistochemistry-Paraffin: Profilin 1 Antibody (5216) [NBP2-59778] - Staining of human fallopian tube shows cytoplasmic immunoreactivity in epithelial cells.")
![Immunohistochemistry-Paraffin: Profilin 1 Antibody (5216) [NBP2-59778] - Staining of human tonsil shows moderate to strong immunoreactivity in lymphoid cells.](http://images.novusbio.com/fullsize/Profilin-1-Antibody-5216-Immunohistochemistry-Paraffin-NBP2-59778-img0002.jpg "Immunohistochemistry-Paraffin: Profilin 1 Antibody (5216) [NBP2-59778] - Staining of human tonsil shows moderate to strong immunoreactivity in lymphoid cells.")
![Immunohistochemistry-Paraffin: Profilin 1 Antibody (5216) [NBP2-59778] - Staining of human liver shows strong immunoreactivity in circulating lymphoid cells.](http://images.novusbio.com/fullsize/Profilin-1-Antibody-5216-Immunohistochemistry-Paraffin-NBP2-59778-img0003.jpg "Immunohistochemistry-Paraffin: Profilin 1 Antibody (5216) [NBP2-59778] - Staining of human liver shows strong immunoreactivity in circulating lymphoid cells.")
![Immunohistochemistry-Paraffin: Profilin 1 Antibody (5216) [NBP2-59778] - Staining of human kidney shows strong membranous combined with moderate cytoplasmic immunoreactivity in renal tubules.](http://images.novusbio.com/fullsize/Profilin-1-Antibody-5216-Immunohistochemistry-Paraffin-NBP2-59778-img0004.jpg "Immunohistochemistry-Paraffin: Profilin 1 Antibody (5216) [NBP2-59778] - Staining of human kidney shows strong membranous combined with moderate cytoplasmic immunoreactivity in renal tubules.")
![Knockout Validated: Profilin 1 Antibody (CL3524) [NBP2-59778] - Lysates of HAP1 WT and PFN1 KO were prepared, and 50 ug of protein were processed for immunoblot with Profilin 1 antibody (NBP2-59778). The Ponceau stained transfer of the blot is shown. Antibody dilution used: NBP2-59778 at 1/1000. Predicted band size: 15 kDa. Image, protocol and testing courtesy of YCharOS Inc. (ycharos.com).](http://images.novusbio.com/fullsize/Profilin-1-Antibody-CL3524-Knockout-Validated-NBP2-59778-img0008.jpg "Knockout Validated: Profilin 1 Antibody (CL3524) [NBP2-59778] - Lysates of HAP1 WT and PFN1 KO were prepared, and 50 ug of protein were processed for immunoblot with Profilin 1 antibody (NBP2-59778). The Ponceau stained transfer of the blot is shown. Antibody dilution used: NBP2-59778 at 1/1000. Predicted band size: 15 kDa. Image, protocol and testing courtesy of YCharOS Inc. (ycharos.com).")
![Western Blot Angiopoietin-like Protein 2/ANGPTL2 Antibody [Unconjugated]](https://images.novusbio.com/images2/Angiopoietinlike_Protein_2_AF1444_Western_Blot_19840.jpg)
