![Western Blot: PPHLN1 Antibody [NBP2-38431] - Analysis: NBP2-38431 (A) shows similar pattern to independent antibody NBP1-89480 (B)](http://images.novusbio.com/fullsize/PPHLN1-Antibody-Western-Blot-NBP2-38431-img0016.jpg "Western Blot: PPHLN1 Antibody [NBP2-38431] - Analysis: NBP2-38431 (A) shows similar pattern to independent antibody NBP1-89480 (B)")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: STAPLFTDQPEEPESNTTHGIELFEDSQLTTRSKAIASKTKEIEQVYRQDCETFGMVVKMLIEKDPSLEKSIQFALRQNLHEIESAGQTWQQVPPVRNTEMDHDG |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PPHLN1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for PPHLN1 Antibody (NBP2-38431)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: PPHLN1 Antibody [NBP2-38431] - Staining of human cell line A-431 shows localization to nucleoplasm & the Golgi apparatus. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/PPHLN1-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-38431-img0004.jpg "Immunocytochemistry/Immunofluorescence: PPHLN1 Antibody [NBP2-38431] - Staining of human cell line A-431 shows localization to nucleoplasm & the Golgi apparatus. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: PPHLN1 Antibody [NBP2-38431] - Staining of human cerebral cortex, colon, liver and testis using Anti-PPHLN1 antibody (A) NBP2-38431 shows similar protein distribution across tissues to independent antibody NBP1-89480 (B).](http://images.novusbio.com/fullsize/PPHLN1-Antibody-Immunohistochemistry-Paraffin-NBP2-38431-img0017.jpg "Immunohistochemistry-Paraffin: PPHLN1 Antibody [NBP2-38431] - Staining of human cerebral cortex, colon, liver and testis using Anti-PPHLN1 antibody (A) NBP2-38431 shows similar protein distribution across tissues to independent antibody NBP1-89480 (B).")
![Immunohistochemistry-Paraffin: PPHLN1 Antibody [NBP2-38431] - Staining of human cerebral cortex shows moderate to strong nuclear positivity in neurons.](http://images.novusbio.com/fullsize/PPHLN1-Antibody-Immunohistochemistry-Paraffin-NBP2-38431-img0012.jpg "Immunohistochemistry-Paraffin: PPHLN1 Antibody [NBP2-38431] - Staining of human cerebral cortex shows moderate to strong nuclear positivity in neurons.")
![Immunohistochemistry-Paraffin: PPHLN1 Antibody [NBP2-38431] - Staining of human colon shows moderate to strong nuclear positivity in glandular cells.](http://images.novusbio.com/fullsize/PPHLN1-Antibody-Immunohistochemistry-Paraffin-NBP2-38431-img0013.jpg "Immunohistochemistry-Paraffin: PPHLN1 Antibody [NBP2-38431] - Staining of human colon shows moderate to strong nuclear positivity in glandular cells.")
![Immunohistochemistry-Paraffin: PPHLN1 Antibody [NBP2-38431] - Staining of human liver shows weak nuclear positivity in hepatocytes.](http://images.novusbio.com/fullsize/PPHLN1-Antibody-Immunohistochemistry-Paraffin-NBP2-38431-img0014.jpg "Immunohistochemistry-Paraffin: PPHLN1 Antibody [NBP2-38431] - Staining of human liver shows weak nuclear positivity in hepatocytes.")
![Immunohistochemistry-Paraffin: PPHLN1 Antibody [NBP2-38431] - Staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/PPHLN1-Antibody-Immunohistochemistry-Paraffin-NBP2-38431-img0015.jpg "Immunohistochemistry-Paraffin: PPHLN1 Antibody [NBP2-38431] - Staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts.")
![Immunohistochemistry Galectin-4 Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af2128_mouse-galectin-4-affinity-purified-polyclonal-ab-immunohistochemistry-29122022154254.jpg)
![Vitronectin [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "Vitronectin [Unconjugated]")
![Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase-3_AF835_Immunocytochemistry_6532.jpg)
![Immunohistochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase3_AF835_Immunohistochemistry_22976.jpg)
![Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase-3_AF835_Immunocytochemistry_9340.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")