Novus Biologicals products are now on bio-techne.com

Plectin Recombinant Protein Antigen

Name: Plectin Recombinant Protein Antigen
Brand: Novus Biologicals
SKU: NBP1-84019PEP
Price: 289 USD

Images

There are currently no images for Plectin Protein (NBP1-84019PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary

Reactivity	HuSpecies Glossary
Applications	AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Plectin Recombinant Protein Antigen Summary

Description	A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PLEC. Source: E. coli Amino Acid Sequence: TEIIRQQGLASYDYVRRRLTAEDLFEARIISLETYNLLREGTRSLREALEAESAWCYLYGTGSVAGVYLPGSRQTLSIYQALKKGLLSAEVARLLLEAQAA Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source	E. coli
Protein/Peptide Type	Recombinant Protein Antigen
Gene	PLEC
Purity	>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions	Antibody Competition 10 - 100 molar excess
Application Notes	This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84019. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW	29 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage	Store at -20C. Avoid freeze-thaw cycles.
Buffer	PBS and 1M Urea, pH 7.4.
Preservative	No Preservative
Purity	>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Plectin Recombinant Protein Antigen

EBS1
HD1
Hemidesmosomal protein 1
LGMD2Q
PCNplectin 1, intermediate filament binding protein, 500kD
PLEC1b
PLEC1EBSO
plectin 1, intermediate filament binding protein 500kDa
plectin
plectin-1
PLTNepidermolysis bullosa simplex 1 (Ogna)

Background

Plectin, a 500-kDa intermediate filament binding protein, is localized to the cytoplasm and acts to both stabilize and give strength to cells via cross-linking (1). Plectin cross-links intermediate filaments to microtubules and microfilaments, and anchors intermediate filaments to the plasma and nuclear membranes (2,3). Plectin binds many proteins, including actin, vimentin, and Lamin B. Phosphorylation by PKA or PKC results in decreased binding to Lamin B, and phosphorylation by PKA enhances the plectin-vimentin interactions (4).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Dystonin Antibody

NBP1-89946

Immunohistochemistry-Paraffin Dystonin Antibody

Species: Hu

Applications: ICC/IF, IHC, IHC-P

PXR/NR1I2 Antibody
(H4417) [Unconjugated ...

PP-H4417-00

(2 Publications)

Species: Hu

Applications: DirELISA, IP, WB

Desmoplakin
Antibody

NBP2-48836

(2 Publications)

Species: Ca, Hu

Applications: ICC/IF, IHC, IHC-P

Vimentin Antibody

NB300-223

Immunohistochemistry-Frozen Vimentin Antibody

(6 Reviews)

(70 Publications)

Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt

Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB

Desmin Antibody
[Unconjugated]

AF3844

Immunocytochemistry/ Immunofluorescence Desmin Antibody [Unconjugated]

(2 Reviews)

(34 Publications)

Species: Hu, Mu

Applications: IHC

Collagen XVII
Antibody (SR46-05)

NBP2-67316

Western Blot Collagen XVII Antibody (SR46-05)

Immunohistochemistry-Paraffin Collagen XVII Antibody (SR46-05)

(1 Publication)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, IP, WB

Cytochrome P450
3A4 Antibody (3H8) - ...

NBP2-37502

Western Blot Cytochrome P450 3A4 Antibody (3H8) - BSA Free

(1 Publication)

Species: Hu

Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB

HAI-2/SPINT2
Antibody [Unconjugate

AF1107

(3 Publications)

Species: Mu

Applications: IHC, WB

Histatin 3
Antibody (4G9)

H00003347-M01

Immunocytochemistry/ Immunofluorescence Histatin 3 Antibody (4G9)

(1 Publication)

Species: Hu

Applications: ELISA, ICC/IF, S-ELISA, WB

Histone
Deacetylase 2/HDAC2 A

NBP1-87109

Western Blot Histone Deacetylase 2/HDAC2 Antibody

Immunohistochemistry-Paraffin Histone Deacetylase 2/HDAC2 Antibody

(1 Publication)

Species: Hu, Mu

Applications: ICC/IF, IHC, IHC-P, KD, WB

Fibronectin
Antibody - BSA Free

NBP1-91258

(11 Reviews)

(56 Publications)

Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt

Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB

Huntingtin Antibody

NBP3-13106

Immunohistochemistry-Paraffin Huntingtin Antibody

Immunocytochemistry/ Immunofluorescence Huntingtin Antibody

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, WB

Periplakin Antibody

NBP2-13795

Species: Hu

Applications: IHC, IHC-P

Dystrophin Antibody

NBP1-89953

(4 Publications)

Species: Hu, Mu

Applications: ICC/IF, IHC, IHC-P

CAR/NR1I3 Antibody
(N4111) [Unconjugated ...

PP-N4111-00

(8 Publications)

Species: Hu

Applications: IHC, IP, WB

NOD2 Antibody
(2D9) - BSA Free

NB100-524

Immunohistochemistry-Frozen NOD2 Antibody (2D9) - BSA Free

(1 Review)

(26 Publications)

Species: Hu, Mu

Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB

CTLA-4
[Unconjugated]

7268-CT

(3 Publications)

Species: Hu

Applications: BA

HLA DQ/DR/DP
Antibody (HLA-Pan/296 ...

NBP2-79843

Immunocytochemistry/ Immunofluorescence HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free

Western Blot HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free

Species: Hu

Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB

Publications for Plectin Protein (NBP1-84019PEP) (0)

There are no publications for Plectin Protein (NBP1-84019PEP).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Plectin Protein (NBP1-84019PEP) (0)

There are no reviews for Plectin Protein (NBP1-84019PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Plectin Protein (NBP1-84019PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Plectin Products

Blogs on Plectin

There are no specific blogs for Plectin, but you can read our latest blog posts.

Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Vimentin Antibody
NB300-223

Fibronectin Antibody - BSA Free
NBP1-91258

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

Mass

Concentration

Volume

Molecular Weight* g/mol

Review this Product

Be the first to review our Plectin Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol

PLEC

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Help Finding Antibodies Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

Plectin Recombinant Protein Antigen

Species Glossary

Images

Product Details

Order Details

Plectin Recombinant Protein Antigen Summary

Applications/Dilutions

Packaging, Storage & Formulations

Alternate Names for Plectin Recombinant Protein Antigen

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for Plectin Protein (NBP1-84019PEP) (0)

Reviews for Plectin Protein (NBP1-84019PEP) (0)

FAQs for Plectin Protein (NBP1-84019PEP) (0)

Additional Plectin Products

Blogs on Plectin

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Molarity Calculator

Review this Product

Bioinformatics