Home » PLC-gamma 1 » PLC-gamma 1 Proteins » PLC-gamma 1 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

PLC-gamma 1 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for PLC-gamma 1 Protein (NBP2-38316PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

100% Guarantee on every product

PLC-gamma 1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PLCG1.

Source: E. coli

Amino Acid Sequence: SAYEEVPTSMMYSENDISNSIKNGILYLEDPVNHEWYPHYFVLTSSKIYYSEETSSDQGNEDEEEPKEVSSSTELHSNEKWFHGKLGAG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PLCG1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38316.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.
Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PLC-gamma 1 Recombinant Protein Antigen

  • EC 3.1.4.11
  • gamma 1 (formerly subtype 148)
  • monophosphatidylinositol phosphodiesterase
  • NCKAP3,1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma-1
  • phosphatidylinositol phospholipase C
  • phosphoinositidase C
  • phosphoinositide phospholipase C
  • Phosphoinositide phospholipase C-gamma-1
  • phospholipase C, gamma 1
  • phospholipase C-148
  • Phospholipase C-gamma-1
  • Phospholipase C-II
  • PLC11-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1
  • PLC148
  • PLC-148
  • PLCG1
  • PLCgamma 1
  • PLC-gamma 1
  • PLC-gamma-1
  • PLC-II1-phosphatidyl-D-myo-inositol-4,5-bisphosphate
  • PPLCA
  • triphosphoinositide phosphodiesterase

Background

Enzymes of the phospholipase C family catalyze the hydrolysis of phospholipids to yield diacylglycerols and water-soluble phosphorylated derivatives of the lipid head groups (1). Phospholipase C gamma 1 (PLC-gamma 1) hydrolyses phosphatidylinositol-4,5-bisphosphate to the second messengers inositol-1,4,5-trisphosphate and diacylglycerol. PLC-gamma 1 also has mitogenic activity upon growth-factor-dependent tyrosine phosphorylation; however, this activity is not dependent on the phospholipase activity of PLC-gamma 1, but requires an SH3 domain (2). Also, results indicate a lipase-independent role of PLC-gamma in the physiological agonist-induced activation of Ca2+ entry (3).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

PLC-beta 1 Antibody
AF4466
Western Blot PLC-beta 1 Antibody
Western Blot PLC-beta 1 Antibody
Species: Hu, Mu
Applications: WB
ERp57/PDIA3
Antibody
NBP1-84796
Western Blot ERp57/PDIA3 Antibody
Immunohistochemistry-Paraffin ERp57/PDIA3 Antibody
Immunohistochemistry-Paraffin ERp57/PDIA3 Antibody
(4 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
PLC-beta 4 Antibody
AF5128
Western Blot PLC-beta 4 Antibody
Species: Hu, Mu, Rt
Applications: WB

Endorepellin/Perlecan/ ...
AF2364
Immunohistochemistry Endorepellin/Perlecan/Heparan Sulfate Proteoglycan Antibody [Unconjugated]
(6 Publications)
Species: Hu
Applications: IHC, WB
GNPDA1 Antibody
NBP2-24653
Western Blot GNPDA1 Antibody
Immunohistochemistry-Paraffin GNPDA1 Antibody
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Glucose 6
phosphate isomerase A ...
NBP2-02541
Western Blot Glucose 6 phosphate isomerase Antibody (OTI2D2)
Immunohistochemistry-Paraffin Glucose 6 phosphate isomerase Antibody (OTI2D2)
Immunohistochemistry-Paraffin Glucose 6 phosphate isomerase Antibody (OTI2D2)
(1 Publication)
Species: Hu, Pm, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
ERK1 Antibody
(1E5) - BSA Free
NBP2-22203
Flow Cytometry ERK1 Antibody (1E5) - BSA Free
Immunocytochemistry/ Immunofluorescence ERK1 Antibody (1E5) - BSA Free
Immunohistochemistry-Paraffin ERK1 Antibody (1E5) - BSA Free
(1 Publication)
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
EGF [Unconjugated]
236-EG
SDS-PAGE EGF [Unconjugated]
Bioactivity EGF [Unconjugated]
Cell Culture EGF [Unconjugated]
(777 Publications)
Species: Hu
Applications: BA
Exosome component
10 Antibody
NBP1-32870
Western Blot Exosome component 10 Antibody
Immunohistochemistry-Paraffin Exosome component 10 Antibody
Western Blot Exosome component 10 Antibody
(2 Reviews)
(3 Publications)
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
PRRT2 Antibody -
BSA Free
NBP2-82026
Western Blot PRRT2 Antibody - BSA Free
Immunohistochemistry PRRT2 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence PRRT2 Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
ERK2 Antibody
[Unconjugated]
AF1230
Western Blot ERK2 Antibody [Unconjugated]
Immunohistochemistry ERK2 Antibody [Unconjugated]
Knockout Validated ERK2 Antibody [Unconjugated]
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
EGFR Antibody
[Unconjugated]
AF231
Immunohistochemistry EGFR Antibody [Unconjugated]
Immunocytochemistry EGFR Antibody [Unconjugated]
Western Blot EGFR Antibody [Unconjugated]
(30 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
Src [p Tyr419]
Antibody [Unconjugate
AF2685
Western Blot Src [p Tyr419] Antibody [Unconjugated]
Simple Western Src [p Tyr419] Antibody [Unconjugated]
Immunohistochemistry Src [p Tyr419] Antibody [Unconjugated]
(1 Review)
(10 Publications)
Species: Hu
Applications: IHC, Simple Western, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(803 Publications)
Species: Hu
Applications: BA

Acetylcholinesterase/A
NB100-1519
Flow Cytometry Acetylcholinesterase/ACHE Antibody
Western Blot Acetylcholinesterase/ACHE Antibody
Immunocytochemistry/ Immunofluorescence Acetylcholinesterase/ACHE Antibody
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-FrFl, PEP-ELISA, WB

FABP8/M-FABP/Myelin P2
AF5866
Western Blot FABP8/M-FABP/Myelin P2 Protein Antibody
Immunohistochemistry FABP8/M-FABP/Myelin P2 Protein Antibody
Immunohistochemistry FABP8/M-FABP/Myelin P2 Protein Antibody
Species: Hu
Applications: IHC, WB
Dystroglycan
Antibody [Unconjugate
AF6868
Immunohistochemistry Dystroglycan Antibody [Unconjugated]
Western Blot Dystroglycan Antibody [Unconjugated]
Knockout Validated Dystroglycan Antibody [Unconjugated]
(21 Publications)
Species: Hu
Applications: IHC, KO, WB
PLC-gamma 1
Recombinant Protein A
NBP2-38316PEP
PLC-gamma 1 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for PLC-gamma 1 Protein (NBP2-38316PEP) (0)

There are no publications for PLC-gamma 1 Protein (NBP2-38316PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PLC-gamma 1 Protein (NBP2-38316PEP) (0)

There are no reviews for PLC-gamma 1 Protein (NBP2-38316PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PLC-gamma 1 Protein (NBP2-38316PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PLC-gamma 1 Products

Research Areas for PLC-gamma 1 Protein (NBP2-38316PEP)

Find related products by research area.

Blogs on PLC-gamma 1

There are no specific blogs for PLC-gamma 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PLC-gamma 1 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol PLCG1