Novus Biologicals products are now on bio-techne.com

PITX2 Recombinant Protein Antigen

Images

 
There are currently no images for PITX2 Recombinant Protein Antigen (NBP2-55572PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

PITX2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PITX2.

Source: E. coli

Amino Acid Sequence: ACVQLGVQPAAVECLFSKDSEIKKVEFTDSPESRKEAASSKFFPRQHPGANEKDKSQQGKNEDVGAEDPSKKKR

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PITX2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55572.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PITX2 Recombinant Protein Antigen

  • all1-responsive gene 1
  • ALL1-responsive protein ARP1
  • ARP1MGC20144
  • Brx1
  • Homeobox protein PITX2
  • IDG2
  • IGDS
  • IGDS2
  • IHG2
  • IRID2
  • Otlx2
  • paired-like homeodomain 2
  • Paired-like homeodomain transcription factor 2MGC111022
  • pituitary homeo box 2
  • pituitary homeobox 2
  • PITX2
  • PTX2
  • RGS
  • RGSRIEG1Brx1
  • rieg bicoid-related homeobox transcription factor 1
  • RIEG bicoid-related homeobox transcription factor
  • RIEG
  • RIEG1
  • RP1
  • RS
  • Solurshin

Background

PITX2 encodes a member of the RIEG/PITX homeobox family, which is in the bicoid class of homeodomain proteins. The encoded protein acts as a transcription factor and regulates procollagen lysyl hydroxylase gene expression. This protein plays a role in the terminal differentiation of somatotroph and lactotroph cell phenotypes, is involved in the development of the eye, tooth and abdominal organs, and acts as a transcriptional regulator involved in basal and hormone-regulated activity of prolactin. Mutations in this gene are associated with Axenfeld-Rieger syndrome, iridogoniodysgenesis syndrome, and sporadic cases of Peters anomaly. A similar protein in other vertebrates is involved in the determination of left-right asymmetry during development. Alternatively spliced transcript variants encoding distinct isoforms have been described.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00005307-M01
Species: Hu
Applications: ELISA, IHC, IHC-P, IP, KD, S-ELISA, WB
NBP2-85481
Species: Hu
Applications: IHC, IHC-P, WB
3218-ND
Species: Hu
Applications: BA
NB100-1268
Species: Hu, Mu, Ze
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, KD, KO, PEP-ELISA, WB
NBP1-92273
Species: Hu, Mu
Applications: IHC, IHC-P
314-BP
Species: Hu
Applications: BA, BA
423-F8
Species: Hu, Mu
Applications: BA
NBP1-32252
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
AF1445
Species: Mu, Rt
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, Simple Western, WB
H00051176-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, KD, PLA, S-ELISA, WB
AF8150
Species: Hu
Applications: ICC, ICFlow, Simple Western, WB
AF2444
Species: Hu
Applications: IHC, WB
NBP2-20486
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP1-52823
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
PP-H7147-00
Species: Hu
Applications: IHC, IP, WB
MAB994
Species: Mu
Applications: WB
NBP2-55572PEP
Species: Hu
Applications: AC

Publications for PITX2 Recombinant Protein Antigen (NBP2-55572PEP) (0)

There are no publications for PITX2 Recombinant Protein Antigen (NBP2-55572PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PITX2 Recombinant Protein Antigen (NBP2-55572PEP) (0)

There are no reviews for PITX2 Recombinant Protein Antigen (NBP2-55572PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PITX2 Recombinant Protein Antigen (NBP2-55572PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PITX2 Products

Research Areas for PITX2 Recombinant Protein Antigen (NBP2-55572PEP)

Find related products by research area.

Blogs on PITX2

There are no specific blogs for PITX2, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PITX2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PITX2