Home » Pit1 » Pit1 Proteins » Recombinant Human Pit1 GST (N-Term) Protein
Novus Biologicals products are now on bio-techne.com

Recombinant Human Pit1 GST (N-Term) Protein

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
12.5% SDS-PAGE Stained with Coomassie Blue.
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, AP

Order Details

Novus Biologicals offers 100% Guarantee

Recombinant Human Pit1 GST (N-Term) Protein Summary

Description
Recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-291 of Human POU1F1

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MSCQAFTSADTFIPLNSDASATLPLIMHHSAAECLPVSNHATNVMSTATGLHYSVPSCHYGNQPSTYGVMAGSLTPCLYKFPDHTLSHGFPPIHQPLLAEDPTAADFKQELRRKSKLVEEPIDMDSPEIRELEKFANEFKVRRIKLGYTQTNVGEALAAVHGSEFSQTTICRFENLQLSFKNACKLKAILSKWLEEAEQVGALYNEKVGANERKRKRRTTISIAAKDALERHFGEQNKPSSQEIMRMAEELNLEKEVVRVWFCNRRQREKRVKTSLNQSLFSISKEHLECR
Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
POU1F1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
59.3 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using H00005449-P01.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Pit1 GST (N-Term) Protein

  • CPHD1
  • GHF1
  • GHF-1pituitary-specific positive transcription factor 1
  • Growth hormone factor 1
  • Pit-1
  • PIT1pituitary-specific transcription factor 1
  • POU class 1 homeobox 1
  • POU domain class 1, transcription factor 1
  • POU domain, class 1, transcription factor 1
  • POU1F1a

Background

This gene encodes a member of the POU family of transcription factors that regulate mammalian development. The protein regulates expression of several genes involved in pituitary development and hormone expression. Mutations in this genes result in combined pituitary hormone deficiency. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Prolactin Antibody
[Unconjugated]
AF1445
Neutralization Prolactin Antibody [Unconjugated]
Western Blot Prolactin Antibody [Unconjugated]
Immunohistochemistry Prolactin Antibody [Unconjugated]
(7 Publications)
Species: Mu, Rt
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, Simple Western, WB
Growth Hormone
Antibody [Unconjugate
AF1067
Western Blot Growth Hormone Antibody [Unconjugated]
ELISA Growth Hormone Antibody [Unconjugated]
Neutralization Growth Hormone Antibody [Unconjugated]
(15 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
gamma-glutamyl
hydrolase Antibody - ...
NBP1-90927
Western Blot gamma-glutamyl hydrolase Antibody - BSA Free
Immunohistochemistry-Paraffin gamma-glutamyl hydrolase Antibody - BSA Free
Immunohistochemistry-Paraffin gamma-glutamyl hydrolase Antibody - BSA Free
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, WB
Growth Hormone
Antibody [Unconjugate
AF1067
Western Blot Growth Hormone Antibody [Unconjugated]
ELISA Growth Hormone Antibody [Unconjugated]
Neutralization Growth Hormone Antibody [Unconjugated]
(15 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
PBX1 Antibody
(4A2) - Azide and BSA ...
H00005087-M01
Western Blot PBX1 Antibody (4A2) - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence PBX1 Antibody (4A2) - Azide and BSA Free
Immunohistochemistry-Paraffin PBX1 Antibody (4A2) - Azide and BSA Free
(12 Publications)
Species: Hu, Pm, Mu
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA, WB
PROP1 Antibody -
BSA Free
NBP3-10488
Western Blot PROP1 Antibody - BSA Free
Species: Hu
Applications: WB
POMC Antibody
NB100-1533
Flow Cytometry POMC Antibody
Immunohistochemistry POMC Antibody
Immunohistochemistry POMC Antibody
(11 Publications)
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Thyrotropin
Releasing Hormone Ant ...
NBP2-34014
Immunohistochemistry-Paraffin Thyrotropin Releasing Hormone Antibody - BSA Free
Immunohistochemistry-Paraffin Thyrotropin Releasing Hormone Antibody - BSA Free
Immunohistochemistry-Paraffin Thyrotropin Releasing Hormone Antibody - BSA Free
Species: Hu
Applications: IHC, IHC-P
IGF-I/IGF-1
[Unconjugated]
291-G1
SDS-PAGE IGF-I/IGF-1 [Unconjugated]
Bioactivity IGF-I/IGF-1 [Unconjugated]
Mass Spectrometry IGF-I/IGF-1 [Unconjugated]
(225 Publications)
Species: Hu
Applications: BA
OCT1 Antibody
NBP2-21584
Western Blot OCT1 Antibody
Immunohistochemistry-Paraffin OCT1 Antibody
Western Blot OCT1 Antibody
(1 Publication)
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
GHRH Antibody -
Azide and BSA Free
NBP3-04850
Western Blot GHRH Antibody - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence GHRH Antibody - Azide and BSA Free
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
SLC20A2 Antibody
(4B1) - Azide and BSA ...
H00006575-M04
ELISA SLC20A2 Antibody (4B1) - Azide and BSA Free
(2 Publications)
Species: Hu, Mu
Applications: ELISA, WB
HESX1 Antibody -
BSA Free
NBP1-89090
Immunohistochemistry-Paraffin HESX1 Antibody - BSA Free
Immunohistochemistry-Paraffin HESX1 Antibody - BSA Free
Immunohistochemistry-Paraffin HESX1 Antibody - BSA Free
Species: Hu
Applications: IHC, IHC-P
PITX2 Antibody
[Unconjugated]
AF7388
Immunohistochemistry PITX2 Antibody [Unconjugated]
(8 Publications)
Species: Hu
Applications: IHC
CBP/KAT3A Antibody
(257003) [Unconjugate ...
MAB2676
Western Blot CBP/KAT3A Antibody (257003) [Unconjugated]
Immunocytochemistry CBP/KAT3A Antibody (257003) [Unconjugated]
(2 Publications)
Species: Hu, Mu, Rt
Applications: ICC, WB
LHX3 Antibody
NBP3-13352
Immunohistochemistry-Paraffin LHX3 Antibody
Immunocytochemistry/ Immunofluorescence LHX3 Antibody
Western Blot LHX3 Antibody
Species: Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
c-jun [p Ser63]
Antibody (1018Y) [Unc ...
MAB8930
Western Blot c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
Immunocytochemistry c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
Simple Western c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
(1 Review)
(3 Publications)
Species: Hu
Applications: ICC, Simple Western, WB
GHRHR Antibody -
BSA Free
NLS836
Immunohistochemistry-Paraffin GHRHR Antibody - BSA Free
Immunohistochemistry-Paraffin GHRHR Antibody - BSA Free
Immunohistochemistry-Paraffin GHRHR Antibody - BSA Free
Species: Hu, Pm, Pm
Applications: IHC, IHC-P
Adenine Nucleotide
Translocator 2 Antibo ...
NBP2-92630
Immunohistochemistry-Paraffin Adenine Nucleotide Translocator 2 Antibody - Azide and BSA Free
Immunohistochemistry-Paraffin Adenine Nucleotide Translocator 2 Antibody - Azide and BSA Free
Western Blot Adenine Nucleotide Translocator 2 Antibody - Azide and BSA Free
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB

SF-1/NR5A1/Steroidogen ...
NBP1-52823
Immunohistochemistry-Paraffin SF-1/NR5A1/Steroidogenic Factor 1 Antibody - BSA Free
Western Blot SF-1/NR5A1/Steroidogenic Factor 1 Antibody - BSA Free
(4 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB

Publications for Pit1 Recombinant Protein (H00005449-P01)(1)


Reviews for Pit1 Recombinant Protein (H00005449-P01) (0)

There are no reviews for Pit1 Recombinant Protein (H00005449-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Pit1 Recombinant Protein (H00005449-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Pit1 Products

Research Areas for Pit1 Recombinant Protein (H00005449-P01)

Find related products by research area.

Blogs on Pit1

There are no specific blogs for Pit1, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Pit1 GST (N-Term) Protein and receive a gift card or discount.


Bioinformatics

Gene Symbol POU1F1