PISD Antibody Summary
Immunogen |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human PISD. Peptide sequence: WKHGFFSLTAVGATNVGSIRIYFDRDLHTNSPRHSKGSYNDFSFVTHTNR The peptide sequence for this immunogen was taken from within the described region. |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
PISD |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS, 2% Sucrose |
Preservative |
0.09% Sodium Azide |
Concentration |
0.5 mg/ml |
Purity |
Affinity purified |
Alternate Names for PISD Antibody
Background
PISD, also referred to as Phosphatidylserine Decarboxylase proenzyme, is cleaved into two mature subunits called Phosphatidylserine decarboxylase alpha chain and Phosphatidylserine decarboxylase beta chain. The PISD proenzyme contains a LGST motif that is an autocatalytic cleavage site where it splits into the alpha chain and beta chain. PISD is part of the phosphatidylserine decarboxylase family and localizes to the mitochondrion. Current research on PISD is being conducted in relation to several diseases and disorders including carcinomas and malaria. Research has shown that PISD interacts with PMM2, SGPL1, DHX29, CRLS1 and NAPEPLD in pathways such as the FOXA1 transcription factor network, the metabolism of lipids and lipoproteins and glycerophospholipid metabolism.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, In, Mu, Pm, Rt
Applications: B/N, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, MiAr, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu, In, Mu, Pm, Rt
Applications: B/N, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rb, Rt
Applications: IHC, IHC-P, IP, KO, WB
Species: Hu, Mu
Applications: Simple Western, WB
Species: Hu, Mu
Applications: ELISA, Flow, Func, WB
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Mu, Rt
Applications: ICC/IF, WB
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Mu, Rt, Ze
Applications: IHC-WhMt, IHC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IP, WB
Species: Hu, Mu
Applications: ICC/IF, WB
Publications for PISD Antibody (NBP2-88055) (0)
There are no publications for PISD Antibody (NBP2-88055).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for PISD Antibody (NBP2-88055) (0)
There are no reviews for PISD Antibody (NBP2-88055).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for PISD Antibody (NBP2-88055) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional PISD Products
Research Areas for PISD Antibody (NBP2-88055)
Find related products by research area.
|
Blogs on PISD