Home » PHC3 » PHC3 Proteins » PHC3 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

PHC3 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for PHC3 Recombinant Protein Antigen (NBP2-56214PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

PHC3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PHC3.

Source: E. coli

Amino Acid Sequence: RSSLLIEQPVKKRPLLDNQVINSVCVQPELQNNTKHADNSSDTEMEDMIAEETLEEMDSELLKCEFCGK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PHC3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56214.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PHC3 Recombinant Protein Antigen

  • DKFZp313K1221
  • early development regulator 3
  • Early development regulatory protein 3
  • EDR3FLJ12729
  • FLJ12967
  • Homolog of polyhomeotic 3
  • HPH3
  • MGC88144
  • PH3
  • polyhomeotic homolog 3 (Drosophila)
  • polyhomeotic like 3 (Drosophila)
  • polyhomeotic like 3
  • polyhomeotic-like protein 3

Background

Polyhomeotic-like 3 (PHC3) is a member of the polycomb family and part of the human polycomb complex, hPRC-H, a complex that represses HOX gene expression throughout development.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

HDC2/PHC2 Antibody
NBP1-91979
Immunohistochemistry-Paraffin HDC2/PHC2 Antibody
Immunocytochemistry/ Immunofluorescence HDC2/PHC2 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P
EDR1/PHC1 Antibody
(1F3F3) - BSA Free
NBP2-37371
ELISA EDR1/PHC1 Antibody (1F3F3) - BSA Free
Western Blot EDR1/PHC1 Antibody (1F3F3) - BSA Free
Western Blot EDR1/PHC1 Antibody (1F3F3) - BSA Free
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, WB
GRHPR Antibody
(OTI2H4)
NBP2-03348
Flow Cytometry GRHPR Antibody (OTI2H4)
Western Blot GRHPR Antibody (OTI2H4)
Immunohistochemistry-Paraffin GRHPR Antibody (OTI2H4)
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Phenylalanine
Hydroxylase Antibody
NBP2-48615
Immunohistochemistry-Paraffin Phenylalanine Hydroxylase Antibody
Immunohistochemistry-Paraffin Phenylalanine Hydroxylase Antibody
Immunohistochemistry-Paraffin Phenylalanine Hydroxylase Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, WB
AGXT Antibody
NBP1-89200
Immunohistochemistry-Paraffin AGXT Antibody
Immunohistochemistry-Paraffin AGXT Antibody
Immunohistochemistry-Paraffin AGXT Antibody
(3 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P, Simple Western, WB
GR/NR3C1 Antibody
(BuGR2) - BSA Free
NB300-731
Flow Cytometry GR/NR3C1 Antibody (BuGR2) - BSA Free
Flow Cytometry GR/NR3C1 Antibody (BuGR2) - BSA Free
Immunocytochemistry/ Immunofluorescence GR/NR3C1 Antibody (BuGR2) - BSA Free
(3 Reviews)
(12 Publications)
Species: Gp, Hu, Mu, Rb, Rt, Sh, Ye
Applications: B/N, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, WB
HNF-3 beta/FoxA2
Antibody [Unconjugate ...
AF2400
Chromatin Immunoprecipitation (ChIP) HNF-3 beta/FoxA2 Antibody [Unconjugated]
Immunocytochemistry HNF-3 beta/FoxA2 Antibody [Unconjugated]
Immunohistochemistry HNF-3 beta/FoxA2 Antibody [Unconjugated]
(98 Publications)
Species: Hu
Applications: ChIP, ICC, IHC, WB
MID1 Antibody
NBP1-26612
Western Blot MID1 Antibody
(2 Publications)
Species: Hu
Applications: IP (-), WB
Doublecortin
Antibody
NBP1-72042
Western Blot Doublecortin Antibody
Immunocytochemistry/ Immunofluorescence Doublecortin Antibody
Immunocytochemistry/ Immunofluorescence Doublecortin Antibody
(5 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA, WB
CD55/DAF Antibody
[Unconjugated]
AF2009
Immunohistochemistry CD55/DAF Antibody [Unconjugated]
Immunocytochemistry CD55/DAF Antibody [Unconjugated]
(8 Publications)
Species: Hu
Applications: ICC, IHC
PLEKHM1 Antibody
NBP2-38449
Immunohistochemistry-Paraffin PLEKHM1 Antibody
Immunohistochemistry-Paraffin PLEKHM1 Antibody
Immunohistochemistry-Paraffin PLEKHM1 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P
OAT Antibody
NBP1-83239
Immunohistochemistry-Paraffin OAT Antibody
Immunohistochemistry-Paraffin OAT Antibody
Immunohistochemistry-Paraffin OAT Antibody
(2 Reviews)
Species: Bv, Hu
Applications: IHC, IHC-P, WB
DHRS4 Antibody
NBP2-98675
Immunohistochemistry-Paraffin DHRS4 Antibody
Immunohistochemistry-Paraffin DHRS4 Antibody
Western Blot DHRS4 Antibody
Species: Hu
Applications: IHC-P, IP, WB
Glutamine
Synthetase Antibody
NB110-41404
Immunocytochemistry/ Immunofluorescence Glutamine Synthetase Antibody
Western Blot Glutamine Synthetase Antibody
Immunohistochemistry Glutamine Synthetase Antibody
(1 Review)
(11 Publications)
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Thromboxane
synthase Antibody (OT
NBP2-02710
Flow Cytometry Thromboxane synthase Antibody (OTI2C1)
Flow Cytometry Thromboxane synthase Antibody (OTI2C1)
Flow Cytometry Thromboxane synthase Antibody (OTI2C1)
(1 Publication)
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Splicing Factor 1
Antibody (2E12)
H00007536-M01
Western Blot Splicing Factor 1 Antibody (2E12)
Western Blot Splicing Factor 1 Antibody (2E12)
Immunocytochemistry/ Immunofluorescence Splicing Factor 1 Antibody (2E12)
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
PDX-1/IPF1
Antibody [Unconjugate
AF2419
Western Blot PDX-1/IPF1 Antibody [Unconjugated]
Immunocytochemistry PDX-1/IPF1 Antibody [Unconjugated]
Simple Western PDX-1/IPF1 Antibody [Unconjugated]
(73 Publications)
Species: Hu
Applications: Dual ISH-IHC, ICC, IHC, Simple Western, WB
PHC3 Recombinant
Protein Antigen
NBP2-56214PEP
PHC3 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for PHC3 Recombinant Protein Antigen (NBP2-56214PEP) (0)

There are no publications for PHC3 Recombinant Protein Antigen (NBP2-56214PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PHC3 Recombinant Protein Antigen (NBP2-56214PEP) (0)

There are no reviews for PHC3 Recombinant Protein Antigen (NBP2-56214PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PHC3 Recombinant Protein Antigen (NBP2-56214PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PHC3 Products

Array NBP2-56214PEP

Research Areas for PHC3 Recombinant Protein Antigen (NBP2-56214PEP)

Find related products by research area.

Blogs on PHC3

There are no specific blogs for PHC3, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PHC3 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol PHC3