![Immunohistochemistry-Paraffin: Periaxin Antibody [NBP1-89598] - Analysis in human lung and liver tissues. Corresponding PRX RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Periaxin-Antibody-Immunohistochemistry-Paraffin-NBP1-89598-img0013.jpg "Immunohistochemistry-Paraffin: Periaxin Antibody [NBP1-89598] - Analysis in human lung and liver tissues. Corresponding PRX RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Mu, CaSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MKVPDMKLPEIKLPKVPEMAVPDVHLPEVQLPKVSEIRLPEMQVPKVPDVHLPKAPEVKLPRAPEVQLKATKAEQAEGMEFGFKMPKMTMPKLGRAESPSRGKPGEAGAEVSGKLVTLPCLQPEVDGEAHVGVPSLTLPSVELDL |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PRX |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot Peroxiredoxin 5 Antibody [Unconjugated]](https://images.novusbio.com/images2/Peroxiredoxin_5_AF5724_Western_Blot_5819.jpg)
![Immunocytochemistry Peroxiredoxin 5 Antibody [Unconjugated]](https://images.novusbio.com/images2/Peroxiredoxin_5_AF5724_Immunocytochemistry__Immunofluorescence_19720.jpg)
![Immunocytochemistry Peroxiredoxin 5 Antibody [Unconjugated]](https://images.novusbio.com/images2/Peroxiredoxin_5_AF5724_Immunocytochemistry__Immunofluorescence_19954.jpg)
| Images | Ratings | Applications | Species | Date | Details | ||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Markus Tammia |
IHC-Fr | Mouse | 07/13/2015 |
Summary
|
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | PRX |
![Immunohistochemistry-Paraffin: Periaxin Antibody [NBP1-89598] - Staining of human lung shows strong membranous positivity in pneumocytes.](http://images.novusbio.com/fullsize/Periaxin-Antibody-Immunohistochemistry-Paraffin-NBP1-89598-img0016.jpg "Immunohistochemistry-Paraffin: Periaxin Antibody [NBP1-89598] - Staining of human lung shows strong membranous positivity in pneumocytes.")
![Immunohistochemistry-Frozen: Periaxin Antibody [NBP1-89598] - Staining of Periaxin in mouse sciatic nerve using anti-Periaxin antibody (green). Image from verified customer review.](http://images.novusbio.com/fullsize/Periaxin-Antibody-Immunohistochemistry-Frozen-NBP1-89598-img0005.jpg "Immunohistochemistry-Frozen: Periaxin Antibody [NBP1-89598] - Staining of Periaxin in mouse sciatic nerve using anti-Periaxin antibody (green). Image from verified customer review.")
![Immunohistochemistry-Paraffin: Periaxin Antibody [NBP1-89598] - Staining of human kidney shows strong membranous positivity in cells in glomeruli.](http://images.novusbio.com/fullsize/Periaxin-Antibody-Immunohistochemistry-Paraffin-NBP1-89598-img0014.jpg "Immunohistochemistry-Paraffin: Periaxin Antibody [NBP1-89598] - Staining of human kidney shows strong membranous positivity in cells in glomeruli.")
![Immunohistochemistry-Paraffin: Periaxin Antibody [NBP1-89598] - Staining of human liver shows no positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize/Periaxin-Antibody-Immunohistochemistry-Paraffin-NBP1-89598-img0015.jpg "Immunohistochemistry-Paraffin: Periaxin Antibody [NBP1-89598] - Staining of human liver shows no positivity in hepatocytes as expected.")
![Immunohistochemistry-Paraffin: Periaxin Antibody [NBP1-89598] - Staining of human testis shows no positivity in cells in seminiferous ducts as expected.](http://images.novusbio.com/fullsize/Periaxin-Antibody-Immunohistochemistry-Paraffin-NBP1-89598-img0017.jpg "Immunohistochemistry-Paraffin: Periaxin Antibody [NBP1-89598] - Staining of human testis shows no positivity in cells in seminiferous ducts as expected.")
![Western Blot Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Western_Blot_5287.jpg)
![Simple Western Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Simple_Western_16990.jpg)
![Knockout Validated Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Knockout_Validated_24032.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
