PEA-15 Antibody Summary
Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human PEA-15. Peptide sequence: DYRTRVLKISEEDELDTKLTRIPSAKKYKDIIRQPSEEEIIKLAPPPKKA The peptide sequence for this immunogen was taken from within the described region. |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
PEA15 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunohistochemistry
- Immunohistochemistry-Paraffin
- Western Blot 1.0 ug/ml
|
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS, 2% Sucrose |
Preservative |
0.09% Sodium Azide |
Concentration |
0.5 mg/ml |
Purity |
Affinity purified |
Alternate Names for PEA-15 Antibody
Background
PEA-15 (phosphoprotein enriched in astrocytes) exists in an non-phosphorylated form (N), and two phosphorylated forms, Pa and Pb. PEA-15 is an endogenous substrate for PKC, which mediates the transition from Pa to Pb. The level of PEA-15 phosphorylation changes upon depolymerization or stabilization of tubulins, indicating that PEA-15 co-localizes with microtubules. The first 80 amino acids of PEA-15 correspond to the death effector domain (DED), which is a domain found in proteins that regulate apoptotic signaling pathways. The DED domain is necessary for PEA-15 to block Ras suppression. Although PEA-15 is predominantly expressed in the central nervous system, low levels of PEA-15 are expressed in liver and kidney, and higher levels in muscle. PEA-15 is also referred to as PED, phosphoprotein enriched in diabetes, for its elevated expression in type 2 diabetic patients.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
Species: Hu, Mu, Rt
Applications: ICC, IHC, IP, WB
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
Species: Ma, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
Species: Hu
Applications: BA
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Species: Hu
Applications: IHC, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rb, V-Vi
Applications: ChIP, IP, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, S-ELISA, WB
Species: Hu
Applications: Flow, ICC/IF, PA
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, WB
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Publications for PEA-15 Antibody (NBP2-88031) (0)
There are no publications for PEA-15 Antibody (NBP2-88031).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for PEA-15 Antibody (NBP2-88031) (0)
There are no reviews for PEA-15 Antibody (NBP2-88031).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for PEA-15 Antibody (NBP2-88031) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional PEA-15 Products
Research Areas for PEA-15 Antibody (NBP2-88031)
Find related products by research area.
|
Blogs on PEA-15