Home » PAPSS2 » PAPSS2 Proteins » PAPSS2 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

PAPSS2 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for PAPSS2 Recombinant Protein Antigen (NBP2-56643PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals offers 100% Guarantee

PAPSS2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PAPSS2.

Source: E. coli

Amino Acid Sequence: VVELLQEQNIVPYTIIKDIHELFVPENKLDHVRAEAETLPSLSITKLDLQWVQV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PAPSS2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56643.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PAPSS2 Recombinant Protein Antigen

  • 3'-phosphoadenosine 5'-phosphosulfate synthase 2
  • ATP sulfurylase/adenosine 5'-phosphosulfate kinase
  • ATPSK2ATP sulfurylase/APS kinase 2
  • bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 2
  • bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthethase 2
  • EC 2.7.1.25
  • PAPS synthase 2
  • PAPS synthetase 2
  • PAPSS 2
  • SK 2
  • SK2
  • Sulfurylase kinase 2,3-prime-phosphoadenosine 5-prime-phosphosulfate synthase 2

Background

Sulfation is a common modification of endogenous (lipids, proteins, and carbohydrates) and exogenous (xenobiotics and drugs) compounds. In mammals, the sulfate source is 3'-phosphoadenosine 5'-phosphosulfate (PAPS), created from ATP and inorganic sulfate. Two different tissue isoforms encoded by different genes synthesize PAPS. This gene encodes one of the two PAPS synthetases. Defects in this gene cause the Pakistani type of spondyloepimetaphyseal dysplasia. Two alternatively spliced transcript variants that encode different isoforms have been described for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

PAPSS1 Antibody -
BSA Free
NBP1-33470
Immunocytochemistry/ Immunofluorescence PAPSS1 Antibody - BSA Free
Immunohistochemistry-Paraffin PAPSS1 Antibody - BSA Free
Western Blot PAPSS1 Antibody - BSA Free
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
KCNN1 Antibody -
Azide and BSA Free
NBP3-04811
Western Blot KCNN1 Antibody - Azide and BSA Free
Species: Hu, Mu
Applications: WB
KCNN3 Antibody
NBP2-85137
Immunohistochemistry-Paraffin KCNN3 Antibody
Western Blot KCNN3 Antibody
Western Blot KCNN3 Antibody
Species: Hu, Pm, Mu
Applications: IHC, IHC-P, WB
KCNN2 Antibody
NBP2-84112
Western Blot KCNN2 Antibody
Western Blot KCNN2 Antibody
Western Blot KCNN2 Antibody
Species: Hu, Pm
Applications: IHC, IHC-P, WB
MBTPS1 Antibody -
Azide and BSA Free
NBP3-05161
Western Blot MBTPS1 Antibody - Azide and BSA Free
Western Blot MBTPS1 Antibody - Azide and BSA Free
Immunohistochemistry MBTPS1 Antibody - Azide and BSA Free
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
KCNN4 Antibody -
BSA Free
NBP2-33694
Immunohistochemistry-Paraffin KCNN4 Antibody - BSA Free
Immunohistochemistry-Paraffin KCNN4 Antibody - BSA Free
Immunohistochemistry-Paraffin KCNN4 Antibody - BSA Free
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Calmodulin 3
Antibody - BSA Free
NBP2-15669
Western Blot Calmodulin 3 Antibody - BSA Free
Western Blot Calmodulin 3 Antibody - BSA Free
Immunohistochemistry Whole-Mount Calmodulin 3 Antibody - BSA Free
(1 Publication)
Species: Mu, Rt, Ze
Applications: IHC-WhMt, IHC, WB
Calmodulin 2
Antibody - BSA Free
NBP2-14871
Immunocytochemistry/ Immunofluorescence Calmodulin 2 Antibody - BSA Free
Western Blot Calmodulin 2 Antibody - BSA Free
(1 Publication)
Species: Mu, Rt
Applications: ICC/IF, WB
Calmodulin
Antibody (2D1) - BSA
NB120-2860
Immunocytochemistry/ Immunofluorescence Calmodulin Antibody (2D1) - BSA Free
Immunocytochemistry/ Immunofluorescence Calmodulin Antibody (2D1) - BSA Free
Immunocytochemistry/ Immunofluorescence Calmodulin Antibody (2D1) - BSA Free
(3 Publications)
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
RED Antibody - BSA
Free
NBP2-20119
Western Blot RED Antibody - BSA Free
Immunohistochemistry-Paraffin RED Antibody - BSA Free
Immunohistochemistry-Paraffin RED Antibody - BSA Free
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Carbonic Anhydrase
I/CA1 Antibody - BSA ...
NBP1-88191
Western Blot Carbonic Anhydrase I/CA1 Antibody - BSA Free
Immunohistochemistry-Paraffin Carbonic Anhydrase I/CA1 Antibody - BSA Free
Immunohistochemistry-Paraffin Carbonic Anhydrase I/CA1 Antibody - BSA Free
(3 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Sphingosine Kinase
1/SPHK1 Antibody (1D6 ...
H00008877-M01
ELISA Sphingosine Kinase 1/SPHK1 Antibody (1D6) - Azide and BSA Free
Western Blot Sphingosine Kinase 1/SPHK1 Antibody (1D6) - Azide and BSA Free
Western Blot Sphingosine Kinase 1/SPHK1 Antibody (1D6) - Azide and BSA Free
(13 Publications)
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
PXR/NR1I2 Antibody
(H4417) [Unconjugated ...
PP-H4417-00
PXR/NR1I2 Antibody (H4417) [Unconjugated]
(2 Publications)
Species: Hu
Applications: DirELISA, IP, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(822 Publications)
Species: Hu
Applications: BA
Cytosolic
Sulfotransferase 2A1/ ...
AF5828
Immunocytochemistry Cytosolic Sulfotransferase 2A1/SULT2A1 Antibody
Western Blot Cytosolic Sulfotransferase 2A1/SULT2A1 Antibody
Species: Hu
Applications: ICC, Neut, WB
CAR/NR1I3 Antibody
(N4111) [Unconjugated ...
PP-N4111-00
CAR/NR1I3 Antibody (N4111) [Unconjugated]
(8 Publications)
Species: Hu
Applications: IHC, IP, WB
Kv1.3 Antibody -
BSA Free
NBP2-48533
Immunohistochemistry-Paraffin Kv1.3 Antibody - BSA Free
Immunohistochemistry-Paraffin Kv1.3 Antibody - BSA Free
Immunohistochemistry-Paraffin Kv1.3 Antibody - BSA Free
Species: Hu
Applications: IHC, IHC-P
ERK2 Antibody
[Unconjugated]
AF1230
Western Blot ERK2 Antibody [Unconjugated]
Immunohistochemistry ERK2 Antibody [Unconjugated]
Knockout Validated ERK2 Antibody [Unconjugated]
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
CDC7 Antibody -
BSA Free
NBP2-32708
Immunohistochemistry-Paraffin CDC7 Antibody - BSA Free
Immunohistochemistry-Paraffin CDC7 Antibody - BSA Free
Immunohistochemistry-Paraffin CDC7 Antibody - BSA Free
(1 Review)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
PAPSS2 Recombinant
Protein Antigen
NBP2-56643PEP
PAPSS2 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for PAPSS2 Recombinant Protein Antigen (NBP2-56643PEP) (0)

There are no publications for PAPSS2 Recombinant Protein Antigen (NBP2-56643PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PAPSS2 Recombinant Protein Antigen (NBP2-56643PEP) (0)

There are no reviews for PAPSS2 Recombinant Protein Antigen (NBP2-56643PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PAPSS2 Recombinant Protein Antigen (NBP2-56643PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PAPSS2 Products

Research Areas for PAPSS2 Recombinant Protein Antigen (NBP2-56643PEP)

Find related products by research area.

Blogs on PAPSS2

There are no specific blogs for PAPSS2, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PAPSS2 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol PAPSS2