![Immunohistochemistry-Paraffin: PACSIN2 Antibody [NBP2-13723] - Staining in human adrenal gland and skeletal muscle tissues using NBP2-13723 antibody. Corresponding PACSIN2 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/PACSIN2-Antibody-Immunohistochemistry-Paraffin-NBP2-13723-img0021.jpg "Immunohistochemistry-Paraffin: PACSIN2 Antibody [NBP2-13723] - Staining in human adrenal gland and skeletal muscle tissues using NBP2-13723 antibody. Corresponding PACSIN2 RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the amino acids: NVPSNPAQSAQSQSSYNPFEDEDDTGSTVSEKDDTKAKNVSSYEKTQSYPTDWS |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PACSIN2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for PACSIN2 Antibody (NBP2-13723)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | PACSIN2 |
![Immunohistochemistry-Paraffin: PACSIN2 Antibody [NBP2-13723] - Staining of human adrenal gland, kidney, pancreas and skeletal muscle using Anti-PACSIN2 antibody NBP2-13723 (A) shows similar protein distribution across tissues to independent antibody NBP2-56701 (B).](http://images.novusbio.com/fullsize/PACSIN2-Antibody-Immunohistochemistry-Paraffin-NBP2-13723-img0016.jpg "Immunohistochemistry-Paraffin: PACSIN2 Antibody [NBP2-13723] - Staining of human adrenal gland, kidney, pancreas and skeletal muscle using Anti-PACSIN2 antibody NBP2-13723 (A) shows similar protein distribution across tissues to independent antibody NBP2-56701 (B).")
![Immunocytochemistry/Immunofluorescence: PACSIN2 Antibody [NBP2-13723] - Staining of human cell line CACO-2 shows localization to nuclear speckles, plasma membrane, cytosol & vesicles. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/PACSIN2-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-13723-img0005.jpg "Immunocytochemistry/Immunofluorescence: PACSIN2 Antibody [NBP2-13723] - Staining of human cell line CACO-2 shows localization to nuclear speckles, plasma membrane, cytosol & vesicles. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: PACSIN2 Antibody [NBP2-13723] - Staining of human adrenal gland shows strong cytoplasmic and membranous positivity in glandular cells.](http://images.novusbio.com/fullsize/PACSIN2-Antibody-Immunohistochemistry-Paraffin-NBP2-13723-img0015.jpg "Immunohistochemistry-Paraffin: PACSIN2 Antibody [NBP2-13723] - Staining of human adrenal gland shows strong cytoplasmic and membranous positivity in glandular cells.")
![Immunohistochemistry-Paraffin: PACSIN2 Antibody [NBP2-13723] - Staining of human kidney shows weak to moderate cytoplasmic positivity in cells in tubules.](http://images.novusbio.com/fullsize/PACSIN2-Antibody-Immunohistochemistry-Paraffin-NBP2-13723-img0017.jpg "Immunohistochemistry-Paraffin: PACSIN2 Antibody [NBP2-13723] - Staining of human kidney shows weak to moderate cytoplasmic positivity in cells in tubules.")
![Immunohistochemistry-Paraffin: PACSIN2 Antibody [NBP2-13723] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.](http://images.novusbio.com/fullsize/PACSIN2-Antibody-Immunohistochemistry-Paraffin-NBP2-13723-img0018.jpg "Immunohistochemistry-Paraffin: PACSIN2 Antibody [NBP2-13723] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.")
![Immunohistochemistry-Paraffin: PACSIN2 Antibody [NBP2-13723] - Staining of human placenta shows weak to moderate cytoplasmic positivity in trophoblastic cells.](http://images.novusbio.com/fullsize/PACSIN2-Antibody-Immunohistochemistry-Paraffin-NBP2-13723-img0019.jpg "Immunohistochemistry-Paraffin: PACSIN2 Antibody [NBP2-13723] - Staining of human placenta shows weak to moderate cytoplasmic positivity in trophoblastic cells.")
![Immunohistochemistry-Paraffin: PACSIN2 Antibody [NBP2-13723] - Staining of human skeletal muscle shows no positivity in myocytes as expected.](http://images.novusbio.com/fullsize/PACSIN2-Antibody-Immunohistochemistry-Paraffin-NBP2-13723-img0020.jpg "Immunohistochemistry-Paraffin: PACSIN2 Antibody [NBP2-13723] - Staining of human skeletal muscle shows no positivity in myocytes as expected.")
![Western Blot Src [p Tyr419] Antibody [Unconjugated]](https://images.novusbio.com/images2/Src_AF2685_Western_Blot_5209.jpg)
![Simple Western Src [p Tyr419] Antibody [Unconjugated]](https://images.novusbio.com/images2/16327.jpg)
![Immunohistochemistry Src [p Tyr419] Antibody [Unconjugated]](https://images.novusbio.com/images2/Src_AF2685_Immunohistochemistry_7158.jpg)
![Holo-Transferrin [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "Holo-Transferrin [Unconjugated]")
![Western Blot Angiopoietin-like Protein 2/ANGPTL2 Antibody [Unconjugated]](https://images.novusbio.com/images2/Angiopoietinlike_Protein_2_AF1444_Western_Blot_19840.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")