Novus Biologicals products are now on bio-techne.com

Recombinant Human p130 GST (N-Term) Protein

Name: Recombinant Human p130 GST (N-Term) Protein
Brand: Novus Biologicals
SKU: H00005934-Q01
Price: 569 USD

Submit a Review

Images

(

Enlarge)

12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary

Reactivity	HuSpecies Glossary
Applications	WB, ELISA, MA, AP

Order Details

100% Guarantee on every product

Recombinant Human p130 GST (N-Term) Protein Summary

Description	A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 416-515 of Human p130 Source: Wheat Germ (in vitro) Amino Acid Sequence: VTPVSTATHSLSRLHTMLTGLRNAPSEKLEQILRTCSRDPTQAIANRLKEMFEIYSQHFQPDEDFSNCAKEIASKHFRFAEMLYYKVLESVIEQEQKRLG
Preparation Method	in vitro wheat germ expression system
Details of Functionality	This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source	Wheat germ
Protein/Peptide Type	Partial Recombinant Protein
Gene	RBL2
Purity	>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions	ELISA Immunoaffinity Purification Protein Array Western Blot
Theoretical MW	36.74 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage	Store at -80C. Avoid freeze-thaw cycles.
Buffer	50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative	No Preservative
Purity	>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human p130 GST (N-Term) Protein

FLJ26459
P130
PRB2
Rb2
RBR-2
retinoblastoma-like 2 (p130)
retinoblastoma-like protein 2,130 kDa retinoblastoma-associated protein
Retinoblastoma-related protein 2

Background

RBL2 - retinoblastoma-like 2 (p130)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

p107 Antibody

NBP2-33735

Immunohistochemistry-Paraffin p107 Antibody

(1 Publication)

Species: Hu

Applications: ICC/IF, IHC, IHC-P, WB

RB1 Antibody
(607121) [Unconjugate

MAB6495

Immunocytochemistry RB1 Antibody (607121) [Unconjugated]

Simple Western RB1 Antibody (607121) [Unconjugated]

(4 Publications)

Species: Hu

Applications: ICC, Simple Western, WB

p130Cas/BCAR1
Antibody (OTI1A9)

NBP2-00532

Species: Ca, Hu, Pm, Mu, Rt

Applications: Flow, ICC/IF, IHC, IHC-P, WB

E2F-4 Antibody

NBP1-21374

(2 Publications)

Species: Hu

Applications: IHC, IHC-P, IP, KD, WB

p21/CIP1/CDKN1A
Antibody (WA-1)

NBP2-29463

(22 Publications)

Species: Pm, Hu, Pm, Mu

Applications: Flow, ICC/IF, IHC, IHC-P, WB

FAK Antibody
[Unconjugated]

AF4467

Knockout Validated FAK Antibody [Unconjugated]

Western Blot FAK Antibody [Unconjugated]

(3 Publications)

Species: Hu, Mu, Rt

Applications: IHC, KO, WB

CDK2 Antibody
(OTI2D9)

NBP2-00776

(1 Review)

Species: Ca, Hu, Pm, Mu, Rt

Applications: Flow, ICC/IF, IHC, IHC-P, WB

Retinoblastoma
binding protein 1 Ant ...

NBP1-26616

Immunoprecipitation Retinoblastoma binding protein 1 Antibody

Species: Hu

Applications: IP, WB

E2F-1 Antibody
(JJ092-02)

NBP2-67899

Immunocytochemistry/ Immunofluorescence E2F-1 Antibody (JJ092-02)

Species: Hu, Mu, Rt

Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB

p120-catenin
Antibody (OTI2E8)

NBP2-45646

Species: Ca, Hu, Mu, Rt

Applications: IHC, IHC-P, WB

CSE1L/CAS/Exportin-2 A

H00001434-M08

Immunohistochemistry-Paraffin CSE1L/CAS/Exportin-2 Antibody (3D8)

(1 Review)

(11 Publications)

Species: Hu, Mu

Applications: ELISA, ICC/IF, IHC, IHC-P, WB

p27/Kip1 [p
Thr157] Antibody

AF1555

(1 Review)

(17 Publications)

Species: Hu

Applications: WB

p53 Antibody (PAb
240) - BSA Free

NB200-103

Flow (Intracellular) p53 Antibody (PAb 240) - BSA Free

(3 Reviews)

(39 Publications)

Species: Hu, Mu, Rt, Xp(-), Ye

Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB

p19ARF/CDKN2A
Antibody - BSA Free

NB200-106

Western Blot p19ARF/CDKN2A Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence p19ARF/CDKN2A Antibody - BSA Free

(1 Review)

(48 Publications)

Species: Mu, Rt

Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB

TCEAL1 Antibody
(OTI2G10)

NBP2-46085

Species: Hu

Applications: IHC, WB

D4S234E Antibody
(1C3)

H00027065-M01

(1 Publication)

Species: Hu, Rt

Applications: ELISA, ICC/IF, S-ELISA, WB

Paxillin Antibody
[Unconjugated]

AF4259

Western Blot Paxillin Antibody [Unconjugated]

Simple Western Paxillin Antibody [Unconjugated]

(7 Publications)

Species: Hu, Mu, Rt

Applications: ICC, Simple Western, WB

CDK4 Antibody

NBP1-31308

(7 Publications)

Species: Bv, Fe, Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, Simple Western, WB

Src [p Tyr419]
Antibody [Unconjugate

AF2685

Simple Western Src [p Tyr419] Antibody [Unconjugated]

Immunohistochemistry Src [p Tyr419] Antibody [Unconjugated]

(1 Review)

(10 Publications)

Species: Hu

Applications: IHC, Simple Western, WB

Recombinant Human
p130 GST (N-Term) Pro ...

H00005934-Q01

Species: Hu

Applications: WB, ELISA, MA, AP

Publications for p130 Partial Recombinant Protein (H00005934-Q01) (0)

There are no publications for p130 Partial Recombinant Protein (H00005934-Q01).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for p130 Partial Recombinant Protein (H00005934-Q01) (0)

There are no reviews for p130 Partial Recombinant Protein (H00005934-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for p130 Partial Recombinant Protein (H00005934-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional p130 Products

Research Areas for p130 Partial Recombinant Protein (H00005934-Q01)

Find related products by research area.

Blogs on p130

There are no specific blogs for p130, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Immunohistochemistry: p19ARF/CDKN2A Antibody [NB200-106] - Adult mouse kidney (glomerulus). Image from verified customer review.

p19ARF/CDKN2A Antibody - BSA Free
NB200-106

Flow Cytometry: p53 Antibody (PAb 240) [NB200-103] - An intracellular stain was performed on HeLa cells with p53 (PAb240) NB200-103AF647 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.

p53 Antibody (PAb 240) - BSA Free
NB200-103

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Review this Product

Be the first to review our Recombinant Human p130 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol

RBL2

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Help Finding Antibodies Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

Recombinant Human p130 GST (N-Term) Protein

Species Glossary

Images

Product Details

Order Details

Recombinant Human p130 GST (N-Term) Protein Summary

Applications/Dilutions

Packaging, Storage & Formulations

Notes

Alternate Names for Recombinant Human p130 GST (N-Term) Protein

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for p130 Partial Recombinant Protein (H00005934-Q01) (0)

Reviews for p130 Partial Recombinant Protein (H00005934-Q01) (0)

Product General Protocols

Video Protocols

FAQs for p130 Partial Recombinant Protein (H00005934-Q01) (0)

Additional p130 Products

Research Areas for p130 Partial Recombinant Protein (H00005934-Q01)

Blogs on p130

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Review this Product

Bioinformatics