![Immunohistochemistry-Paraffin: Ornithine Carbamoyltransferase Antibody (CL4045) [NBP2-59038] - Staining in human liver and tonsil tissues. Corresponding OTC RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Ornithine-Carbamoyltransferase-Antibody-CL4045-Immunohistochemistry-Paraffin-NBP2-59038-img0012.jpg "Immunohistochemistry-Paraffin: Ornithine Carbamoyltransferase Antibody (CL4045) [NBP2-59038] - Staining in human liver and tonsil tissues. Corresponding OTC RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Pm-Cm, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clone | CL4045 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ILADYLTLQEHYSSLKGLTLSWIGDGNNILHSIMMSAAKFGMHLQAATPKGYEPDASVTKLAEQYAKENGTKLLLTNDPLEAAHGGNVLITDTWISMGQEEEKKKRLQAFQGYQVTMKTAKVAASDWT |
| Epitope | GYEPDASVTKLAEQY |
| Predicted Species | Mouse (93%), Rat (92%). Backed by our 100% Guarantee. |
| Isotype | IgG2a |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | OTC |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. For ICC/IF, PFA/Triton X-100 is recommended for fixation/permeabilization. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Protein A purified |
![Simple Western Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Simple_Western_21888.jpg)
![Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunocytochemistry__Immunofluorescence_17777.jpg)
![Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunohistochemistry_23317.jpg)
| Publication using NBP2-59038 | Applications | Species |
|---|---|---|
| Wang L, Warzecha C, Kistner A et al. Prednisolone reduces the interferon response to AAV in cynomolgus macaques and may increase liver gene expression [113/120 characters] Molecular Therapy - Methods & Clinical Development 2022-01-01 [PMID: 35211641] (IHC-P, Cynomolgus Monkey) | IHC-P | Cynomolgus Monkey |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | OTC |
![Western Blot: Ornithine Carbamoyltransferase Antibody (CL4045) [NBP2-59038] - Analysis in human liver tissue.](http://images.novusbio.com/fullsize/Ornithine-Carbamoyltransferase-Antibody-CL4045-Western-Blot-NBP2-59038-img0006.jpg "Western Blot: Ornithine Carbamoyltransferase Antibody (CL4045) [NBP2-59038] - Analysis in human liver tissue.")
![Immunocytochemistry/Immunofluorescence: Ornithine Carbamoyltransferase Antibody (CL4045) [NBP2-59038] - Staining of RH-30 cells using the Anti-OTC monoclonal antibody, showing specific staining in mitochondria in green. Microtubule- and nuclear probes are visualized in red and blue, respectively (where available).](http://images.novusbio.com/fullsize/Ornithine-Carbamoyltransferase-Antibody-CL4045-Immunocytochemistry-Immunofluorescence-NBP2-59038-img0013.jpg "Immunocytochemistry/Immunofluorescence: Ornithine Carbamoyltransferase Antibody (CL4045) [NBP2-59038] - Staining of RH-30 cells using the Anti-OTC monoclonal antibody, showing specific staining in mitochondria in green. Microtubule- and nuclear probes are visualized in red and blue, respectively (where available).")
![Immunohistochemistry-Paraffin: Ornithine Carbamoyltransferase Antibody (CL4045) [NBP2-59038] - Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.](http://images.novusbio.com/fullsize/Ornithine-Carbamoyltransferase-Antibody-CL4045-Immunohistochemistry-Paraffin-NBP2-59038-img0007.jpg "Immunohistochemistry-Paraffin: Ornithine Carbamoyltransferase Antibody (CL4045) [NBP2-59038] - Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.")
![Immunohistochemistry-Paraffin: Ornithine Carbamoyltransferase Antibody (CL4045) [NBP2-59038] - Staining of human duodenum shows strong granular cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/Ornithine-Carbamoyltransferase-Antibody-CL4045-Immunohistochemistry-Paraffin-NBP2-59038-img0008.jpg "Immunohistochemistry-Paraffin: Ornithine Carbamoyltransferase Antibody (CL4045) [NBP2-59038] - Staining of human duodenum shows strong granular cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: Ornithine Carbamoyltransferase Antibody (CL4045) [NBP2-59038] - Staining of human small intestine shows strong granular cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/Ornithine-Carbamoyltransferase-Antibody-CL4045-Immunohistochemistry-Paraffin-NBP2-59038-img0009.jpg "Immunohistochemistry-Paraffin: Ornithine Carbamoyltransferase Antibody (CL4045) [NBP2-59038] - Staining of human small intestine shows strong granular cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: Ornithine Carbamoyltransferase Antibody (CL4045) [NBP2-59038] - Staining of human tonsil shows no positivity in lymphoid cells as expected.](http://images.novusbio.com/fullsize/Ornithine-Carbamoyltransferase-Antibody-CL4045-Immunohistochemistry-Paraffin-NBP2-59038-img0010.jpg "Immunohistochemistry-Paraffin: Ornithine Carbamoyltransferase Antibody (CL4045) [NBP2-59038] - Staining of human tonsil shows no positivity in lymphoid cells as expected.")
![Immunohistochemistry CD55/DAF Antibody [Unconjugated]](https://images.novusbio.com/images2/CD55_AF2009_Immunohistochemistry_6728.jpg)
![Immunocytochemistry CD55/DAF Antibody [Unconjugated]](https://images.novusbio.com/images2/CD55_AF2009_Immunocytochemistry__Immunofluorescence_23052.jpg)
