![Western Blot: NSUN2 Antibody [NBP1-82189] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using anti-NSUN2 antibody. Remaining relative intensity is presented.](http://images.novusbio.com/fullsize/NSUN2-Antibody-Western-Blot-NBP1-82189-img0006.jpg "Western Blot: NSUN2 Antibody [NBP1-82189] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using anti-NSUN2 antibody. Remaining relative intensity is presented.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC, KD |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PFVFIPEDDPLFPPIEKFYALDPSFPRMNLLTRTTEGKKRQLYMVSKELRNVLLNNSEKMKVINTGIKVWCRNNSGEEFDCAFRLAQ |
| Predicted Species | Mouse (100%), Rat (100%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | NSUN2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | NSUN2 |
![Immunohistochemistry-Paraffin: NSUN2 Antibody [NBP1-82189] - Staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/NSUN2-Antibody-Immunohistochemistry-Paraffin-NBP1-82189-img0010.jpg "Immunohistochemistry-Paraffin: NSUN2 Antibody [NBP1-82189] - Staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts.")
![Immunohistochemistry-Paraffin: NSUN2 Antibody [NBP1-82189] - Staining of human duodenum shows moderate nuclear and cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/NSUN2-Antibody-Immunohistochemistry-Paraffin-NBP1-82189-img0007.jpg "Immunohistochemistry-Paraffin: NSUN2 Antibody [NBP1-82189] - Staining of human duodenum shows moderate nuclear and cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: NSUN2 Antibody [NBP1-82189] - Staining of human skeletal muscle shows very weak nuclear positivity in myocytes as expected.](http://images.novusbio.com/fullsize/NSUN2-Antibody-Immunohistochemistry-Paraffin-NBP1-82189-img0008.jpg "Immunohistochemistry-Paraffin: NSUN2 Antibody [NBP1-82189] - Staining of human skeletal muscle shows very weak nuclear positivity in myocytes as expected.")
![Immunohistochemistry-Paraffin: NSUN2 Antibody [NBP1-82189] - Staining of human skin shows weak to moderate nuclear positivity in squamous epithelial cells.](http://images.novusbio.com/fullsize/NSUN2-Antibody-Immunohistochemistry-Paraffin-NBP1-82189-img0009.jpg "Immunohistochemistry-Paraffin: NSUN2 Antibody [NBP1-82189] - Staining of human skin shows weak to moderate nuclear positivity in squamous epithelial cells.")
![Immunohistochemistry Ret Antibody [Unconjugated]](https://images.novusbio.com/images2/Ret_AF482_Immunohistochemistry_10194.jpg)
![Western Blot Ret Antibody [Unconjugated]](https://images.novusbio.com/images/af482_mouse-ret-affinity-purified-polyclonal-ab-8220249503265.jpg)
![Immunohistochemistry Ret Antibody [Unconjugated]](https://images.novusbio.com/images/af482_mouse-ret-affinity-purified-polyclonal-ab-8220249505961.jpg)
![Immunohistochemistry Patched 1/PTCH Antibody (413220) [Unconjugated] - (First Extracellular Loop)](https://images.novusbio.com/images2/Patched_1_MAB41051_Immunohistochemistry_15456.jpg)
![Western Blot Patched 1/PTCH Antibody (413220) [Unconjugated] - (First Extracellular Loop)](https://images.novusbio.com/images2/Patched_1_MAB41051_Western_Blot_10905.jpg)
![Immunohistochemistry Patched 1/PTCH Antibody (413220) [Unconjugated] - (First Extracellular Loop)](https://images.novusbio.com/images2/Patched_1_MAB41051_Immunohistochemistry_7016.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")