Home » Neurofibromin 1 » Neurofibromin 1 Proteins » Recombinant Human Neurofibromin 1 GST (N-Term) Protein
Novus Biologicals products are now on bio-techne.com

Recombinant Human Neurofibromin 1 GST (N-Term) Protein

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
12.5% SDS-PAGE Stained with Coomassie Blue.
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, AP

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Recombinant Human Neurofibromin 1 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 2719-2818 of Human Neurofibromin 1

Source: Wheat Germ (in vitro)

Amino Acid Sequence: DTYLPGIDEETSEESLLTPTSPYPPALQSQLSITANLNLSNSMTSLATSQHSPGIDKENVELSPTTGHCNSGRTRHGSASQVQKQRSAGSFKRNSIKKIV
Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
NF1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using H00004763-Q01.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Neurofibromin 1 GST (N-Term) Protein

  • DKFZp686J1293
  • FLJ21220
  • Neurofibromatosis-related protein NF-1
  • neurofibromin 1
  • neurofibromin
  • NFNS
  • VRNF
  • WSS

Background

NF1 - neurofibromin 1 (neurofibromatosis, von Recklinghausen disease, Watson disease)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

p53 Antibody (PAb
240) - BSA Free
NB200-103
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow (Intracellular) p53 Antibody (PAb 240) - BSA Free
(3 Reviews)
(42 Publications)
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
HRAS Antibody
NBP2-42864
Western Blot HRAS Antibody
Western Blot HRAS Antibody
Western Blot HRAS Antibody
(2 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NF2/Merlin Antibody
NBP1-87757
Immunocytochemistry/ Immunofluorescence NF2/Merlin Antibody
Immunohistochemistry-Paraffin NF2/Merlin Antibody
Immunohistochemistry-Paraffin NF2/Merlin Antibody
(3 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
c-jun [p Ser63]
Antibody (1018Y) [Unc ...
MAB8930
Western Blot c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
Immunocytochemistry c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
Simple Western c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
(1 Review)
(3 Publications)
Species: Hu
Applications: ICC, Simple Western, WB
Complement Factor
D/Adipsin Antibody [U ...
AF5430
Western Blot Complement Factor D/Adipsin Antibody [Unconjugated]
(13 Publications)
Species: Mu
Applications: IP, WB
PIKFyve/PIP5K3
Antibody (6C7)
H00200576-M01
Immunocytochemistry/ Immunofluorescence PIKFyve/PIP5K3 Antibody (6C7)
Immunohistochemistry-Paraffin PIKFyve/PIP5K3 Antibody (6C7)
Western Blot PIKFyve/PIP5K3 Antibody (6C7)
(4 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, KD, S-ELISA, WB
Ras-GAP Antibody
AF5094
Western Blot Ras-GAP Antibody
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB
TOR/mTOR [p
Ser2448] Antibody
NB600-607
Immunohistochemistry-Paraffin TOR/mTOR [p Ser2448] Antibody
Western Blot TOR/mTOR [p Ser2448] Antibody
Data TOR/mTOR [p Ser2448] Antibody
(2 Reviews)
(9 Publications)
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, WB
YB1 Antibody
NBP1-89945
Immunohistochemistry-Paraffin YB1 Antibody
Immunohistochemistry-Paraffin YB1 Antibody
Immunohistochemistry-Paraffin YB1 Antibody
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
SP1 Antibody
NB600-232
Western Blot SP1 Antibody
Immunohistochemistry-Paraffin SP1 Antibody
Western Blot SP1 Antibody
(1 Review)
(7 Publications)
Species: Hu, Mu
Applications: ChIP, IHC, IHC-P, IP, WB
PSG1 [HRP]
DPSG10
N/A PSG1 [HRP]
N/A PSG1 [HRP]
(2 Publications)
Species: Hu
Applications: ELISA
COCO/DAND5
[Unconjugated]
3047-CC
COCO/DAND5 [Unconjugated]
(4 Publications)
Species: Hu
Applications: BA
ERK2 Antibody
[Unconjugated]
AF1230
Western Blot ERK2 Antibody [Unconjugated]
Immunohistochemistry ERK2 Antibody [Unconjugated]
Knockout Validated ERK2 Antibody [Unconjugated]
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
AKT [p Ser473]
Antibody [Unconjugate ...
AF887
Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
(49 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
EGFR Antibody
[Unconjugated]
AF231
Immunohistochemistry EGFR Antibody [Unconjugated]
Immunocytochemistry EGFR Antibody [Unconjugated]
Western Blot EGFR Antibody [Unconjugated]
(30 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
NFIC Antibody
(1C12-2A2)
H00004782-M01
Western Blot NFIC Antibody (1C12-2A2)
Immunocytochemistry/ Immunofluorescence NFIC Antibody (1C12-2A2)
Immunohistochemistry-Paraffin NFIC Antibody (1C12-2A2)
(1 Publication)
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, WB

Publications for Neurofibromin 1 Partial Recombinant Protein (H00004763-Q01)(1)


Reviews for Neurofibromin 1 Partial Recombinant Protein (H00004763-Q01) (0)

There are no reviews for Neurofibromin 1 Partial Recombinant Protein (H00004763-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Neurofibromin 1 Partial Recombinant Protein (H00004763-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Neurofibromin 1 Products

Research Areas for Neurofibromin 1 Partial Recombinant Protein (H00004763-Q01)

Find related products by research area.

Blogs on Neurofibromin 1.

Check out the latest blog posts on Neurofibromin 1.
Developmental regulator Daam2 promotes glial cell tumors by degrading Von Hippel-Lindau protein
By Jamshed Arslan Pharm.D. Glioblastoma is an aggressive type of cancer that forms from the star-shaped glial cells of the central nervous system, called astrocytes. Intriguingly, several genes linked to glioblasto...  Read full blog post.
Neurofibromatosis Infographic
Neurofibromatosis (NF) is a genetic disorder caused by mutations in the NF1, NF2 or SMARCB1 genes which lead to tumor growth on nerves throughout the body. Although the tumors are usually benign, they still require chemotherapy to shrink and may becom...  Read full blog post.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Flow Cytometry: p53 Antibody (PAb 240) [NB200-103] - An intracellular stain was performed on HeLa cells with p53 (PAb240) NB200-103AF647 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.
p53 Antibody (PAb 240) - BSA Free
NB200-103

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Neurofibromin 1 GST (N-Term) Protein and receive a gift card or discount.


Bioinformatics

Gene Symbol NF1