Novus Biologicals products are now on bio-techne.com

Netrin-1 Recombinant Protein Antigen

Images

 
There are currently no images for Netrin-1 Protein (NBP2-31640PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Netrin-1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NTN1.

Source: E. coli

Amino Acid Sequence: GDWWKFTVNIISVYKQGTSRIRRGDQSLWIRSRDIACKCPKIKPLKKYLLLGNAEDSPDQSGIVADKSSLVIQWRDTWARRLRKFQQREKKGKCK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
NTN1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-31640.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Netrin-1 Recombinant Protein Antigen

  • netrin 1
  • Netrin1
  • Netrin-1
  • NTN1
  • NTN1Lnetrin 1, mouse, homolog of

Background

Semaphorins, neuropilins and netrins are among a number of molecules and their receptors that regulate the developing nervous system to guide the development of neural circuits.1 Although first identified as axon guidance cues,2,3 it is now apparent that many of these same factors are not limited to the guidance of growing axons, but have roles in a range of processes from the guidance of cell migration to the regulation of the immune response, angiogenesis, lung branching morphogenesis, nervous system regeneration, and cancer.4-9 The semaphorins make up the largest family of axon guidance cues. They are characterized by the presence of an approximately 500 amino acid N-terminal semaphorin (Sema) domain. Semaphorins function mainly as chemorepellents that direct axons away from tissues.3 Semaphorin 3A (Sema3A) has been shown to be repellent to cortical axons and to inhibit axon branching.10 The transmembrane protein semaphorin 6A has been shown to repel embryonic sympathetic axons.11 The actions of the various semaphorins are not always similar. Semaphorin 3A has been found to inhibit tumor development whereas semaphorin 6A may contribute to tumor progression.9 Neuropilins are the ligand binding moieties in the class 3 Semaphorin receptor complexes that subsequently activate signaling through associated plexins. Two types have been identified so far: Neuropilin-1 (Npn-1) and Neuropilin-2 (Npn-2) receptors. At the amino acid sequence level, Npn-1 and Npn-2 share 44% identity. Npn-1 and Npn-2 show different expression patterns in developing neurons of the central and peripheral nervous systems, and show different binding specificities for different members of he semaphorin family. Both also function as receptors for some forms of vascular endothelial growth factor (VEGF).12 Netrins are a family of laminin-related small proteins that are involved in axon guidance and eurite outgrowth. Netrin-1 has been shown to attract cortical growth cones and promote axon branching.10 Netrin-4 (first named b-netrin) was found to promote neurite elongation from olfactory bulb explants.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF844
Species: Mu
Applications: Block, IHC, WB
AF1006
Species: Rt
Applications: IHC, WB
MAB1005
Species: Hu
Applications: IHC, WB
AF1079
Species: Hu, Mu
Applications: Block, IHC, Simple Western, WB
1250-S3
Species: Hu
Applications: BA, BA
5444-SL
Species: Mu
Applications: BA
MAB3629
Species: Mu
Applications: IHC
AF1405
Species: Rt
Applications: Block, ICC, WB
6514-SL
Species: Hu
Applications: BA
DBD00
Species: Hu
Applications: ELISA
AF4467
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
AF1166
Species: Mu
Applications: WB
DVE00
Species: Hu
Applications: ELISA
AF3147
Species: Hu
Applications: CyTOF-ready, Flow, ICC, WB
DY1857
Species: Mu
Applications: ELISA
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP1-58359
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-59690
Species: Am, Av, Fi, Ma, Ze
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IP, WB
NB300-109
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB

Publications for Netrin-1 Protein (NBP2-31640PEP) (0)

There are no publications for Netrin-1 Protein (NBP2-31640PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Netrin-1 Protein (NBP2-31640PEP) (0)

There are no reviews for Netrin-1 Protein (NBP2-31640PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Netrin-1 Protein (NBP2-31640PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Netrin-1 Products

Research Areas for Netrin-1 Protein (NBP2-31640PEP)

Find related products by research area.

Blogs on Netrin-1

There are no specific blogs for Netrin-1, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Netrin-1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol NTN1