![Immunohistochemistry-Paraffin: NECAB1 Antibody [NBP1-84004] - Analysis in human cerebral cortex and liver tissues. Corresponding NECAB1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/NECAB1-Antibody-Immunohistochemistry-Paraffin-NBP1-84004-img0025.jpg "Immunohistochemistry-Paraffin: NECAB1 Antibody [NBP1-84004] - Analysis in human cerebral cortex and liver tissues. Corresponding NECAB1 RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LLKETLNQLQSLQNSLECAMETTEEQTRQERQGPAKPEVLSIQWPGKRSSRRVQRHNSFSPNSP |
| Predicted Species | Rat (98%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | NECAB1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | NECAB1 |
![Immunohistochemistry-Paraffin: NECAB1 Antibody [NBP1-84004] - Staining of human cerebral cortex, colon, liver and pancreas using Anti-NECAB1 antibody NBP1-84004 (A) shows similar protein distribution across tissues to independent antibody NBP1-84003 (B).](http://images.novusbio.com/fullsize/NECAB1-Antibody-Immunohistochemistry-Paraffin-NBP1-84004-img0035.jpg "Immunohistochemistry-Paraffin: NECAB1 Antibody [NBP1-84004] - Staining of human cerebral cortex, colon, liver and pancreas using Anti-NECAB1 antibody NBP1-84004 (A) shows similar protein distribution across tissues to independent antibody NBP1-84003 (B).")
![Western Blot: NECAB1 Antibody [NBP1-84004] - Analysis using Anti-NECAB1 antibody NBP1-84004 (A) shows similar pattern to independent antibody NBP1-84003 (B).](http://images.novusbio.com/fullsize/NECAB1-Antibody-Western-Blot-NBP1-84004-img0032.jpg "Western Blot: NECAB1 Antibody [NBP1-84004] - Analysis using Anti-NECAB1 antibody NBP1-84004 (A) shows similar pattern to independent antibody NBP1-84003 (B).")
![Immunohistochemistry-Paraffin: NECAB1 Antibody [NBP1-84004] - Staining of human pancreas.](http://images.novusbio.com/fullsize/NECAB1-Antibody-Immunohistochemistry-Paraffin-NBP1-84004-img0021.jpg "Immunohistochemistry-Paraffin: NECAB1 Antibody [NBP1-84004] - Staining of human pancreas.")
![Immunohistochemistry-Paraffin: NECAB1 Antibody [NBP1-84004] - Staining of human liver shows not positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize/NECAB1-Antibody-Immunohistochemistry-Paraffin-NBP1-84004-img0026.jpg "Immunohistochemistry-Paraffin: NECAB1 Antibody [NBP1-84004] - Staining of human liver shows not positivity in hepatocytes as expected.")
![Immunohistochemistry-Paraffin: NECAB1 Antibody [NBP1-84004] - Staining human cerebral cortex shows strong cytoplasmic positivity in neurons.](http://images.novusbio.com/fullsize/NECAB1-Antibody-Immunohistochemistry-Paraffin-NBP1-84004-img0027.jpg "Immunohistochemistry-Paraffin: NECAB1 Antibody [NBP1-84004] - Staining human cerebral cortex shows strong cytoplasmic positivity in neurons.")
![Immunohistochemistry-Paraffin: NECAB1 Antibody [NBP1-84004] - Staining of human colon shows no positivityin glandular cells as expected.](http://images.novusbio.com/fullsize/NECAB1-Antibody-Immunohistochemistry-Paraffin-NBP1-84004-img0030.jpg "Immunohistochemistry-Paraffin: NECAB1 Antibody [NBP1-84004] - Staining of human colon shows no positivityin glandular cells as expected.")
![Immunohistochemistry: NECAB1 Antibody [NBP1-84004] - Staining of mouse parietal association cortex shows distinct positivity in layer 4 neurons.](http://images.novusbio.com/fullsize/NECAB1-Antibody-Immunohistochemistry-NBP1-84004-img0013.jpg "Immunohistochemistry: NECAB1 Antibody [NBP1-84004] - Staining of mouse parietal association cortex shows distinct positivity in layer 4 neurons.")
![Immunohistochemistry: NECAB1 Antibody [NBP1-84004] - Staining of mouse hippocampus shows immunoreactivity in a subset of interneurons.](http://images.novusbio.com/fullsize/NECAB1-Antibody-Immunohistochemistry-NBP1-84004-img0014.jpg "Immunohistochemistry: NECAB1 Antibody [NBP1-84004] - Staining of mouse hippocampus shows immunoreactivity in a subset of interneurons.")
![Immunohistochemistry: NECAB1 Antibody [NBP1-84004] - Staining of mouse superior colliculi shows positivity in a subset of neurons.](http://images.novusbio.com/fullsize/NECAB1-Antibody-Immunohistochemistry-NBP1-84004-img0015.jpg "Immunohistochemistry: NECAB1 Antibody [NBP1-84004] - Staining of mouse superior colliculi shows positivity in a subset of neurons.")
![Immunohistochemistry: NECAB1 Antibody [NBP1-84004] - Staining of mouse vestibular nucleus shows immunoreactivity in a subset of neurons.](http://images.novusbio.com/fullsize/NECAB1-Antibody-Immunohistochemistry-NBP1-84004-img0016.jpg "Immunohistochemistry: NECAB1 Antibody [NBP1-84004] - Staining of mouse vestibular nucleus shows immunoreactivity in a subset of neurons.")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")