Novus Biologicals products are now on bio-techne.com

Myt1 Recombinant Protein Antigen

Name: Myt1 Recombinant Protein Antigen
Brand: Novus Biologicals
SKU: NBP1-81021PEP
Price: 279 USD

Images

There are currently no images for Myt1 Protein (NBP1-81021PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary

Reactivity	HuSpecies Glossary
Applications	AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Myt1 Recombinant Protein Antigen Summary

Description	A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MYT1. Source: E. coli Amino Acid Sequence: EAAPDVIFQEDTSHTSAQKAPELRGPESPSPKPEYSVIVEVRSDDDKDEDTHSRKSTVTDESEMQDMMTRGNLGLLEQAIALKAEQVRTVCEPGCPPAEQSQLGLGEPGKAAKPLDT Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source	E. coli
Protein/Peptide Type	Recombinant Protein Antigen
Gene	MYT1
Purity	>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions	Antibody Competition 10 - 100 molar excess
Application Notes	This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-81021. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW	30 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage	Store at -20C. Avoid freeze-thaw cycles.
Buffer	PBS and 1M Urea, pH 7.4.
Preservative	No Preservative
Purity	>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Myt1 Recombinant Protein Antigen

C20orf36
KIAA0835
KIAA1050
MTF1
MTF1proteolipid protein binding protein
myelin transcription factor 1
Myelin transcription factor I
Myt1
MyTI
MYTIKIAA0835
PLPB1
PLPB1KIAA1050
Proteolipid protein-binding protein

Background

MYT1, also known as Myelin transcription factor 1, consists of a long 1,121 amino acid isoform that is 122 kDa, and is involved in the development of the central nervous system and the regulation of oligodendrocyte lineage development. Current research is being conducted on the relationship between MYT1 and a variety of diseases and disorders, including multiple sclerosis, papillary thyroid carcinoma, leukomalacia, neuronitis, sporadic breast cancer, skin cancer, pancreatitis, schizophrenia, thyroiditis, and carcinoma. The protein interacts with SIN3B, PIN1, PLK1, HDAC1, and CDK1, and has been linked to pancreatic and breast cancer pathways, as well as G1 to S cell cycle control.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

CDC2/CDK1 Antibody

NBP1-85729

(5 Publications)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, WB

Wee1 Antibody

NBP1-33506

Immunohistochemistry-Paraffin Wee1 Antibody

(2 Publications)

Species: Hu, Mu

Applications: IHC, IHC-P, WB

DNA Polymerase
delta, catalytic subu ...

NBP2-33466

Species: Hu

Applications: ICC/IF, IHC, IHC-P, WB

Myelin PLP Antibody

NB100-74503

(7 Publications)

Species: Mu, Rt

Applications: ICC/IF, WB

CDC25C Antibody
(461908) [Unconjugate

MAB4459

(2 Publications)

Species: Hu, Mu, Rt

Applications: WB

Cyclin B1 Antibody
[Unconjugated]

AF6000

Western Blot Cyclin B1 Antibody [Unconjugated]

Simple Western Cyclin B1 Antibody [Unconjugated]

(12 Publications)

Species: Hu, Mu

Applications: IHC, Simple Western, WB

Peroxiredoxin 5
Antibody [Unconjugate

AF5724

Immunocytochemistry Peroxiredoxin 5 Antibody [Unconjugated]

Species: Hu, Mu, Rt

Applications: ICC, WB

PDXP Antibody -
Azide and BSA Free

NBP2-93574

Immunocytochemistry/ Immunofluorescence PDXP Antibody - Azide and BSA Free

Immunohistochemistry-Paraffin PDXP Antibody - Azide and BSA Free

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, WB

PTHLH/PTHrP
Antibody (677939) [Un ...

MAB6734

(2 Publications)

Species: Hu

Applications: IHC

RASGRF1 Antibody

NBP3-13291

Immunohistochemistry-Paraffin RASGRF1 Antibody

Species: Mu, Rt

Applications: WB

MBP Antibody (12)

NB600-717

Immunocytochemistry/ Immunofluorescence MBP Antibody (12)

(3 Reviews)

(42 Publications)

Species: Bv

Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RIA, RI, WB

PKMYT1 Antibody
(OTI5E1)

NBP2-02275

Species: Hu, Mu, Rt

Applications: Flow, ICC/IF, IHC, IHC-P, WB

MYT1L Antibody -
BSA Free

NBP2-81742

Immunocytochemistry/ Immunofluorescence MYT1L Antibody - BSA Free

Species: Hu, Mu, Rt

Applications: ELISA, ICC/IF, WB

CDK2 Antibody
(OTI2D9)

NBP2-00776

(1 Review)

Species: Ca, Hu, Pm, Mu, Rt

Applications: Flow, ICC/IF, IHC, IHC-P, WB

PLK1 Antibody
(OTI1D4)

NBP1-48291

Immunohistochemistry-Paraffin PLK1 Antibody (OTI1D4)

(1 Review)

Species: Hu, Mu, Rt

Applications: Flow, IHC, IHC-P, IP, WB

Mesothelin
Antibody (420411) [Un ...

MAB32652

ELISA Mesothelin Antibody (420411) [Unconjugated]

Flow Cytometry Mesothelin Antibody (420411) [Unconjugated]

(3 Publications)

Species: Hu

Applications: CyTOF-ready, ELISA, Flow, KO

Chk1 Antibody

NB100-464

Immunohistochemistry-Paraffin Chk1 Antibody

(12 Publications)

Species: Hu, Mu

Applications: IHC, IHC-P, IP, WB

Neurogenin-3
Antibody [Unconjugate

AF3444

Immunohistochemistry Neurogenin-3 Antibody [Unconjugated]

(19 Publications)

Species: Hu

Applications: IHC, WB

MBP-1 Antibody -
Azide and BSA Free

NBP3-04784

Immunohistochemistry-Paraffin MBP-1 Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence MBP-1 Antibody - Azide and BSA Free

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, WB

MBL Antibody

AF2307

(9 Publications)

Species: Hu

Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), WB

Publications for Myt1 Protein (NBP1-81021PEP) (0)

There are no publications for Myt1 Protein (NBP1-81021PEP).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Myt1 Protein (NBP1-81021PEP) (0)

There are no reviews for Myt1 Protein (NBP1-81021PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Myt1 Protein (NBP1-81021PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Myt1 Products

Research Areas for Myt1 Protein (NBP1-81021PEP)

Find related products by research area.

Blogs on Myt1

There are no specific blogs for Myt1, but you can read our latest blog posts.

Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

MBP Antibody (12)
NB600-717

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

Mass

Concentration

Volume

Molecular Weight* g/mol

Review this Product

Be the first to review our Myt1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol

MYT1

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Help Finding Antibodies Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

Myt1 Recombinant Protein Antigen

Species Glossary

Images

Product Details

Order Details

Myt1 Recombinant Protein Antigen Summary

Applications/Dilutions

Packaging, Storage & Formulations

Alternate Names for Myt1 Recombinant Protein Antigen

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for Myt1 Protein (NBP1-81021PEP) (0)

Reviews for Myt1 Protein (NBP1-81021PEP) (0)

FAQs for Myt1 Protein (NBP1-81021PEP) (0)

Additional Myt1 Products

Research Areas for Myt1 Protein (NBP1-81021PEP)

Blogs on Myt1

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Molarity Calculator

Review this Product

Bioinformatics