![Immunohistochemistry-Paraffin: MUC17 Antibody [NBP1-91013] - Analysis in human small intestine and fallopian tube tissues. Corresponding MUC17 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/MUC17-Antibody-Immunohistochemistry-Paraffin-NBP1-91013-img0011.jpg "Immunohistochemistry-Paraffin: MUC17 Antibody [NBP1-91013] - Analysis in human small intestine and fallopian tube tissues. Corresponding MUC17 RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: NPTSTPTVPRTTTCFGDGCQNTASRCKNGGTWDGLKCQCPNLYYGELCEEVVSSIDIGPPETISAQMELTVTVTSVKFTEELKNHSSQEFQEFKQTFTEQMNIVYSGIPEYVGVNITKLRLGSVVVEHDVLLRTKYTPEYK |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | MUC17 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunohistochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunohistochemistry_20892.jpg)
![Immunocytochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunocytochemistry__Immunofluorescence_21143.jpg)
![Western Blot EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Western_Blot_19925.jpg)
| Images | Ratings | Applications | Species | Date | Details | ||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
-(01-ml)_NBP1-91013_10556.jpg)
Enlarge |
reviewed by:
Ming Lu |
WB | Human | 09/26/2014 |
Summary
|
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | MUC17 |
![Western Blot: MUC17 Antibody [NBP1-91013] - Analysis of AsPC-1 cell lysate (20ug loaded). Image from verified customer review.](http://images.novusbio.com/fullsize/MUC17-Antibody-Western-Blot-NBP1-91013-img0003.jpg "Western Blot: MUC17 Antibody [NBP1-91013] - Analysis of AsPC-1 cell lysate (20ug loaded). Image from verified customer review.")
![Immunohistochemistry-Paraffin: MUC17 Antibody [NBP1-91013] - Staining of human duodenum shows moderate membranous positivity in glandular cells.](http://images.novusbio.com/fullsize/MUC17-Antibody-Immunohistochemistry-Paraffin-NBP1-91013-img0012.jpg "Immunohistochemistry-Paraffin: MUC17 Antibody [NBP1-91013] - Staining of human duodenum shows moderate membranous positivity in glandular cells.")
![Immunohistochemistry-Paraffin: MUC17 Antibody [NBP1-91013] - Staining of human fallopian tube shows no positivity in glandular cells as expected.](http://images.novusbio.com/fullsize/MUC17-Antibody-Immunohistochemistry-Paraffin-NBP1-91013-img0008.jpg "Immunohistochemistry-Paraffin: MUC17 Antibody [NBP1-91013] - Staining of human fallopian tube shows no positivity in glandular cells as expected.")
![Immunohistochemistry-Paraffin: MUC17 Antibody [NBP1-91013] - Staining of human colon shows weak cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/MUC17-Antibody-Immunohistochemistry-Paraffin-NBP1-91013-img0009.jpg "Immunohistochemistry-Paraffin: MUC17 Antibody [NBP1-91013] - Staining of human colon shows weak cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: MUC17 Antibody [NBP1-91013] - Staining of human small intestine shows moderate membranous positivity in glandular cells.](http://images.novusbio.com/fullsize/MUC17-Antibody-Immunohistochemistry-Paraffin-NBP1-91013-img0010.jpg "Immunohistochemistry-Paraffin: MUC17 Antibody [NBP1-91013] - Staining of human small intestine shows moderate membranous positivity in glandular cells.")
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Immunohistochemistry CFTR Antibody (24-1) [Unconjugated] - C-terminus](https://images.novusbio.com/images2/CFTR_MAB25031_Immunohistochemistry_6973.jpg)
![Immunohistochemistry CFTR Antibody (24-1) [Unconjugated] - C-terminus](https://images.novusbio.com/images2/CFTR_MAB25031_Immunohistochemistry_9671.jpg)
![Immunoprecipitation CFTR Antibody (24-1) [Unconjugated] - C-terminus](https://images.novusbio.com/images/mab25031_human-cftr-c-terminus-mab-clone-24-1-41202412513815.jpg)
![N/A TFF3 [HRP]](https://images.novusbio.com/images2/TFF3_DTFF30_ELISA_460.jpg)
![N/A TFF3 [HRP]](https://images.novusbio.com/images2/DATA_TFF3_DTFF30_ELISA_840.jpg)
![CA125/MUC16 [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "CA125/MUC16 [Unconjugated]")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
-(01-ml)_NBP1-91013_10556.jpg)