Home » MSP/MST1 » MSP/MST1 Proteins » MSP/MST1 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

MSP/MST1 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for MSP/MST1 Protein (NBP1-85330PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

MSP/MST1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MST1.

Source: E. coli

Amino Acid Sequence: RENFCRNPDGDSHGPWCYTMDPRTPFDYCALRRCADDQPP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MST1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85330.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.
Theoretical MW
22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MSP/MST1 Recombinant Protein Antigen

  • D3F15S2
  • EC 3.4.21
  • hepatocyte growth factor-like protein homolog
  • HGFL
  • HGFLhepatocyte growth factor-like protein
  • macrophage stimulating 1 (hepatocyte growth factor-like)
  • Macrophage stimulatory protein
  • Macrophage-stimulating protein
  • MSP
  • MSPDNF15S2
  • MST1
  • NF15S2
  • SF2

Background

Mammalian STE20-like kinase 1, or MST-1, is a serine/threonine kinase that, upon cleavage, has been implicated in the promotion of chromatin condensation. MST-1 is also known as KRS2 and STK4. The C-terminus of MST-1 contains two functional NESs (nuclear export signals), which are released upon caspase-mediated cleavage. The N-terminus portion of the protein then translocates to the nucleus and will promote chromatin condensation at sufficiently high levels. Full-length MST-1 is localized to the cytoplasm.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

p19ARF/CDKN2A
Antibody - BSA Free
NB200-106
Immunohistochemistry p19ARF/CDKN2A Antibody - BSA Free
Western Blot p19ARF/CDKN2A Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence p19ARF/CDKN2A Antibody - BSA Free
(1 Review)
(48 Publications)
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
HGF [Unconjugated]
294-HG
Bioactivity HGF [Unconjugated]
Cell Culture HGF [Unconjugated]
(111 Publications)
Species: Hu
Applications: BA
MSPR/Ron [p
Tyr1238, p Tyr1239, p ...
AF1947
Western Blot MSPR/Ron [p Tyr1238, p Tyr1239, p Tyr1239] Antibody [Unconjugated]
Western Blot MSPR/Ron [p Tyr1238, p Tyr1239, p Tyr1239] Antibody [Unconjugated]
Western Blot MSPR/Ron [p Tyr1238, p Tyr1239, p Tyr1239] Antibody [Unconjugated]
(12 Publications)
Species: Hu
Applications: WB
RASSF1 Antibody
(OTI2B11)
NBP2-03644
Flow Cytometry RASSF1 Antibody (OTI2B11)
Western Blot RASSF1 Antibody (OTI2B11)
Immunohistochemistry-Paraffin RASSF1 Antibody (OTI2B11)
(1 Publication)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
MGMT Antibody (MT
23.2) - BSA Free
NB100-168
Flow (Intracellular) MGMT Antibody (MT 23.2) - BSA Free
Flow Cytometry MGMT Antibody (MT 23.2) - BSA Free
Flow (Intracellular) MGMT Antibody (MT 23.2) - BSA Free
(21 Publications)
Species: Hu, Mu(-)
Applications: CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
E-Cadherin
Antibody [Unconjugate
AF748
Immunocytochemistry E-Cadherin Antibody [Unconjugated]
Immunohistochemistry E-Cadherin Antibody [Unconjugated]
Immunocytochemistry E-Cadherin Antibody [Unconjugated]
(136 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, ICC, IHC, Simple Western, WB
MLH1 Antibody
(SP08-04)
NBP2-67381
Flow Cytometry MLH1 Antibody (SP08-04)
Immunocytochemistry/ Immunofluorescence MLH1 Antibody (SP08-04)
Immunohistochemistry-Paraffin MLH1 Antibody (SP08-04)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
MST2/STK3 Antibody
(OTI4G10)
NBP1-48017
Immunohistochemistry-Paraffin MST2/STK3 Antibody (OTI4G10)
Immunohistochemistry-Paraffin MST2/STK3 Antibody (OTI4G10)
Immunohistochemistry-Paraffin MST2/STK3 Antibody (OTI4G10)
Species: Ca, Hu, Pm, Mu, Rt
Applications: IHC, IHC-P, WB
SUB1 Antibody
NBP1-82454
Immunohistochemistry-Paraffin SUB1 Antibody
Immunohistochemistry-Paraffin SUB1 Antibody
Immunohistochemistry-Paraffin SUB1 Antibody
(2 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
MST1/STK4 Antibody
(1D7-8A10)
H00006789-M01
ELISA MST1/STK4 Antibody (1D7-8A10)
Immunocytochemistry/ Immunofluorescence MST1/STK4 Antibody (1D7-8A10)
Immunohistochemistry-Paraffin MST1/STK4 Antibody (1D7-8A10)
(2 Publications)
Species: Hu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, PLA, WB
p53 Antibody (PAb
240) - BSA Free
NB200-103
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow (Intracellular) p53 Antibody (PAb 240) - BSA Free
(3 Reviews)
(42 Publications)
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
p15INK4b/CDKN2B
Antibody (OTI3B6)
NBP2-45603
Flow Cytometry p15INK4b/CDKN2B Antibody (OTI3B6)
Immunohistochemistry p15INK4b/CDKN2B Antibody (OTI3B6)
Immunohistochemistry p15INK4b/CDKN2B Antibody (OTI3B6)
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
APC Antibody - BSA
Free
NB100-91662
Immunocytochemistry/ Immunofluorescence APC Antibody - BSA Free
Flow Cytometry APC Antibody - BSA Free
Immunohistochemistry-Paraffin APC Antibody - BSA Free
(2 Publications)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
DNMT1 Antibody
(60B1220.1) - BSA Fre
NB100-56519
Flow Cytometry DNMT1 Antibody (60B1220.1) - BSA Free
Flow Cytometry DNMT1 Antibody (60B1220.1) - BSA Free
Immunoprecipitation DNMT1 Antibody (60B1220.1) - BSA Free
(4 Reviews)
(144 Publications)
Species: Bv, Hu, Mu, Po, Rt, Sh
Applications: ChIP, CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, KD, Simple Western, WB
Glutathione
S-Transferase pi 1/GS ...
NBP2-16756
Western Blot Glutathione S-Transferase pi 1/GSTP1 Antibody
Immunocytochemistry/ Immunofluorescence Glutathione S-Transferase pi 1/GSTP1 Antibody
Immunohistochemistry-Paraffin Glutathione S-Transferase pi 1/GSTP1 Antibody
(1 Review)
(2 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
RAR beta/NR1B2
Antibody (336)
NB200-323
Western Blot RAR beta/NR1B2 Antibody (336)
(2 Reviews)
(1 Publication)
Species: Hu, Rt
Applications: WB
S100A9 Antibody
[Unconjugated]
AF2065
Immunocytochemistry S100A9 Antibody [Unconjugated]
Immunohistochemistry S100A9 Antibody [Unconjugated]
Immunocytochemistry S100A9 Antibody [Unconjugated]
(2 Reviews)
(34 Publications)
Species: Mu
Applications: ICC, IHC, Simple Western, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(808 Publications)
Species: Hu
Applications: BA

Publications for MSP/MST1 Protein (NBP1-85330PEP) (0)

There are no publications for MSP/MST1 Protein (NBP1-85330PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MSP/MST1 Protein (NBP1-85330PEP) (0)

There are no reviews for MSP/MST1 Protein (NBP1-85330PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for MSP/MST1 Protein (NBP1-85330PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MSP/MST1 Products

Research Areas for MSP/MST1 Protein (NBP1-85330PEP)

Find related products by research area.

Blogs on MSP/MST1

There are no specific blogs for MSP/MST1, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005
Flow Cytometry: DNMT1 Antibody (60B1220.1) [NB100-56519] - Analysis of PE conjugate of NB100-56519. An intracellular stain was performed on HeLa cells with DNMT1 antibody (60B1220.1) NB100-56519PE (blue) and a matched isotype control NBP2-27287PE (orange). Cells were fixed with 4% PFA and then permeablized with 0
DNMT1 Antibody (60B1220.1) - BSA Free
NB100-56519

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our MSP/MST1 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol MST1