Home » MRPS12 » MRPS12 Proteins » MRPS12 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

MRPS12 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for MRPS12 Protein (NBP2-13620PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

MRPS12 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MRPS12.

Source: E. coli

Amino Acid Sequence: MSWSGLLHGLNTSLTCGPALVPRLWATCSMATLNQMHRL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MRPS12
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-13620.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MRPS12 Recombinant Protein Antigen

  • 28S ribosomal protein S12, mitochondrial
  • mitochondrial ribosomal protein S12
  • MPR-S12
  • MRP-S12
  • MT-RPS12
  • ribosomal protein, mitochondrial, S12
  • RPMS12
  • RPS12
  • RPSM12S12mt

Background

MRPS12, also known as Mitochondrial Ribosomal Protein S12, consists of a 138 amino acid isoform that is 15 kDa, and is involved in the synthesis of proteins within the mitochondria, though its specific purpose is unknown. MRPS12 is currently being used in research with several diseases and disorders, such as autosomal dominant nonsyndromic deafness, esophageal carcinoma, mycobacterium tuberculosis, esophagitis, pneumonia, carcinoma, malaria, and sensorineural hearing loss, to determine its relationship with each condition. MRPS12 interacts with SPINK7, C14orf1, UNC119, CRMP1, and LRIF1 during the process of translation.(provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

PSMD7 Antibody
NBP2-38780
Immunocytochemistry/ Immunofluorescence PSMD7 Antibody
Immunohistochemistry-Paraffin PSMD7 Antibody
Western Blot PSMD7 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
5-HT1B Antibody
NB100-56350
Western Blot 5-HT1B Antibody
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB
RPS7 Antibody (3G4)
H00006201-M03
Western Blot RPS7 Antibody (3G4)
Immunocytochemistry/ Immunofluorescence RPS7 Antibody (3G4)
Immunohistochemistry-Paraffin RPS7 Antibody (3G4)
(3 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
SARS2 Antibody
NBP2-20262
Immunocytochemistry/ Immunofluorescence SARS2 Antibody
Western Blot SARS2 Antibody
Immunohistochemistry-Paraffin SARS2 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Proteasome 19S S7
Antibody
NBP1-87797
Western Blot Proteasome 19S S7 Antibody
Immunohistochemistry-Paraffin Proteasome 19S S7 Antibody
Simple Western Proteasome 19S S7 Antibody
(2 Reviews)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, Simple Western, WB
CD20 Antibody
(AISB12) - BSA Free
NBP1-43435
Western Blot CD20 Antibody (AISB12) - BSA Free
Flow Cytometry CD20 Antibody (AISB12) - BSA Free
(3 Publications)
Species: Hu, Mu
Applications: Flow, WB
TUFM Antibody
(CL2242)
NBP2-36751
Immunocytochemistry/ Immunofluorescence TUFM Antibody (CL2242)
Immunocytochemistry/ Immunofluorescence TUFM Antibody (CL2242)
Immunohistochemistry-Paraffin TUFM Antibody (CL2242)
(2 Publications)
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
RPS3 Antibody
NBP1-33691
Immunocytochemistry/ Immunofluorescence RPS3 Antibody
Immunohistochemistry-Paraffin RPS3 Antibody
Immunohistochemistry-Paraffin RPS3 Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
CLPP Antibody
NBP1-89557
Immunohistochemistry-Paraffin CLPP Antibody
Immunohistochemistry-Paraffin CLPP Antibody
Immunohistochemistry-Paraffin CLPP Antibody
(4 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, KD, WB
Myosin Heavy Chain
Antibody (MF20) [Unco ...
MAB4470
Immunohistochemistry Myosin Heavy Chain Antibody (MF20) [Unconjugated]
Immunohistochemistry Myosin Heavy Chain Antibody (MF20) [Unconjugated]
Immunocytochemistry Myosin Heavy Chain Antibody (MF20) [Unconjugated]
(1 Review)
(166 Publications)
Species: All-Multi
Applications: Flow, ICC, IHC, WB
RPS2 Antibody (3G6)
H00006187-M01
Western Blot RPS2 Antibody (3G6)
Immunocytochemistry/ Immunofluorescence RPS2 Antibody (3G6)
Immunohistochemistry-Paraffin RPS2 Antibody (3G6)
(2 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
CBF2 Antibody
NBP2-47525
Immunohistochemistry CBF2 Antibody
Western Blot CBF2 Antibody
(2 Reviews)
Species: Hu
Applications: IHC, IHC-P, WB
COX-2 Antibody
NB100-689
Immunohistochemistry-Paraffin COX-2 Antibody
Simple Western COX-2 Antibody
(1 Review)
(36 Publications)
Species: Hu, Rt
Applications: IHC, IHC-Fr, IHC-P, Simple Western, WB
COX-1 Antibody
NBP1-85500
Immunocytochemistry/ Immunofluorescence COX-1 Antibody
Immunohistochemistry-Paraffin COX-1 Antibody
Immunohistochemistry-Paraffin COX-1 Antibody
(1 Review)
(3 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
RPS10 Antibody
NBP1-31357
Western Blot RPS10 Antibody
Immunocytochemistry/ Immunofluorescence RPS10 Antibody
Immunohistochemistry-Paraffin RPS10 Antibody
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
MT-ATP6 Antibody -
Azide and BSA Free
NBP3-05578
Immunocytochemistry/ Immunofluorescence MT-ATP6 Antibody - Azide and BSA Free
Western Blot MT-ATP6 Antibody - Azide and BSA Free
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
RPS14 Antibody
NBP1-84847
Immunocytochemistry/ Immunofluorescence RPS14 Antibody
Immunohistochemistry-Paraffin RPS14 Antibody
Immunohistochemistry-Paraffin RPS14 Antibody
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
MRP1 Antibody
(IU2H10) - BSA Free
NB400-156
Dual RNAscope ISH-IHC MRP1 Antibody (IU2H10) - BSA Free
Western Blot MRP1 Antibody (IU2H10) - BSA Free
Immunocytochemistry/ Immunofluorescence MRP1 Antibody (IU2H10) - BSA Free
(17 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Dual ISH-IHC, ELISA, Flow, ICC/IF, IHC, IP, Simple Western, WB

Publications for MRPS12 Protein (NBP2-13620PEP) (0)

There are no publications for MRPS12 Protein (NBP2-13620PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MRPS12 Protein (NBP2-13620PEP) (0)

There are no reviews for MRPS12 Protein (NBP2-13620PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for MRPS12 Protein (NBP2-13620PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MRPS12 Products

Blogs on MRPS12

There are no specific blogs for MRPS12, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Myosin Heavy Chain was detected in immersion fixed paraffin-embedded sections of human skeletal muscle using Mouse Anti-Myosin Heavy Chain Monoclonal Antibody (Catalog # MAB4470) at 5 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Mouse IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC001). Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to sarcoplasm. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
Myosin Heavy Chain Antibody (MF20) [Unconjugated]
MAB4470
Immunohistochemistry-Paraffin: COX-2 Antibody [NB100-689] - Formalin fixed paraffin embedded colon carcinoma stained with COX-2 antibody (NB100-689).
COX-2 Antibody
NB100-689

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our MRPS12 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol MRPS12