Home » MGST2 » MGST2 Proteins » MGST2 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

MGST2 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for MGST2 Protein (NBP1-82653PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

MGST2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MGST2.

Source: E. coli

Amino Acid Sequence: LKYKVTPPAVTGSPEFERVFRAQQNCVEFYPIF

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MGST2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-82653.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MGST2 Recombinant Protein Antigen

  • EC 2.5.1.18
  • FLJ27438
  • GST2MGC14097
  • MGST-II
  • microsomal glutathione S-transferase 2
  • Microsomal GST-2
  • Microsomal GST-II
  • truncated microsomal glutathione S-transferase 2

Background

Characterized as important mediators of inflammation, MGST2 (microsomal glutathione S-transferase 2) is an important regulator of leukotriene and glutathione. MGST2 belongs to the MAPEG (Membrane Associated Proteins in Eicosanoid and Glutathione metabolism) family of six human proteins. Several of these proteins are involved in the creation of leukotrienes and prostaglandin E. MGST2 catalyzes the production of LTC4 from LTA4 and reduced glutathione, and also catalyzes the conjugation of 1-chloro-2, 4-dinitrobenzene with reduced glutathione. Diseases associated with this gene include psoriasis, asthma, leukemia, prostatitis, breast cancer and progressive familial intrahepatic cholestasis type 1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

GST Epitope Tag
Antibody - BSA Free
NB600-326
Western Blot GST Epitope Tag Antibody - BSA Free
Simple Western GST Epitope Tag Antibody - BSA Free
Simple Western GST Epitope Tag Antibody - BSA Free
(2 Reviews)
(18 Publications)
Species: ET
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
Glutathione S
Transferase kappa 1 A ...
NBP2-16686
Western Blot Glutathione S Transferase kappa 1 Antibody
Western Blot Glutathione S Transferase kappa 1 Antibody
Immunohistochemistry-Paraffin Glutathione S Transferase kappa 1 Antibody
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KO, WB
SLCO6A1 Antibody
NBP2-49118
Immunohistochemistry-Paraffin SLCO6A1 Antibody
Immunohistochemistry-Paraffin SLCO6A1 Antibody
Immunohistochemistry-Paraffin SLCO6A1 Antibody
Species: Hu
Applications: IHC, IHC-P
Glutathione
S-Transferase pi 1/GS ...
NBP2-16756
Western Blot Glutathione S-Transferase pi 1/GSTP1 Antibody
Immunocytochemistry/ Immunofluorescence Glutathione S-Transferase pi 1/GSTP1 Antibody
Immunohistochemistry-Paraffin Glutathione S-Transferase pi 1/GSTP1 Antibody
(1 Review)
(2 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
LTC4S Antibody
NBP1-69315
Western Blot LTC4S Antibody
Western Blot LTC4S Antibody
Species: Hu
Applications: WB
GSPT1 Antibody
(HL1346) - Azide and ...
NBP3-25493
Immunohistochemistry-Paraffin GSPT1 Antibody (HL1346) - Azide and BSA Free
Immunohistochemistry-Paraffin GSPT1 Antibody (HL1346) - Azide and BSA Free
Immunohistochemistry-Paraffin GSPT1 Antibody (HL1346) - Azide and BSA Free
Species: Ca, Fe, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Carbohydrate
Sulfotransferase 4/CH ...
AF5357
Western Blot Carbohydrate Sulfotransferase 4/CHST4 Antibody [Unconjugated]
Species: Hu
Applications: IP, Neut, WB
MGST3 Antibody
NBP3-17058
Immunohistochemistry-Paraffin MGST3 Antibody
Immunohistochemistry-Paraffin MGST3 Antibody
Immunohistochemistry-Paraffin MGST3 Antibody
Species: Hu
Applications: IHC, IHC-P
IL-12/IL-23 p40
[HRP]
P1240
N/A IL-12/IL-23 p40 [HRP]
N/A IL-12/IL-23 p40 [HRP]
N/A IL-12/IL-23 p40 [HRP]
(4 Publications)
Species: Po
Applications: ELISA
FLAP Antibody
NB300-891
Immunohistochemistry-Paraffin FLAP Antibody
Immunohistochemistry-Paraffin FLAP Antibody
Immunocytochemistry/ Immunofluorescence FLAP Antibody
(12 Publications)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
Leukotriene A4
Hydrolase/LTA4H Antib ...
NBP1-47829
Immunohistochemistry-Paraffin Leukotriene A4 Hydrolase/LTA4H Antibody (OTI1E9)
Immunohistochemistry-Paraffin Leukotriene A4 Hydrolase/LTA4H Antibody (OTI1E9)
Immunohistochemistry-Paraffin Leukotriene A4 Hydrolase/LTA4H Antibody (OTI1E9)
(3 Reviews)
(1 Publication)
Species: Ca, Hu, Pm, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Prostaglandin E
Synthase Antibody
NBP1-87852
Immunohistochemistry-Paraffin Prostaglandin E Synthase Antibody
Immunohistochemistry-Paraffin Prostaglandin E Synthase Antibody
Immunohistochemistry-Paraffin Prostaglandin E Synthase Antibody
(6 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P

Lymphotoxin-alpha/TNF- ...
211-TBB/CF
SDS-PAGE Lymphotoxin-alpha/TNF-beta [Unconjugated]
Bioactivity Lymphotoxin-alpha/TNF-beta [Unconjugated]
(8 Publications)
Species: Hu
Applications: BA
5-Lipoxygenase
Antibody - BSA Free
NB110-58748
Western Blot 5-Lipoxygenase Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence 5-Lipoxygenase Antibody - BSA Free
Simple Western 5-Lipoxygenase Antibody - BSA Free
(2 Reviews)
(3 Publications)
Species: Hu, Mu
Applications: ICC/IF, KD, Simple Western, WB
GSTM2 Antibody
(1E10)
H00002946-M03
Western Blot GSTM2 Antibody (1E10)
Immunocytochemistry/ Immunofluorescence GSTM2 Antibody (1E10)
Immunohistochemistry-Paraffin GSTM2 Antibody (1E10)
(2 Publications)
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
SOD1/Cu-Zn SOD
Antibody
NBP2-24915
Western Blot SOD1/Cu-Zn SOD Antibody
Western Blot SOD1/Cu-Zn SOD Antibody
Immunohistochemistry-Paraffin SOD1/Cu-Zn SOD Antibody
(3 Reviews)
(21 Publications)
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
CAR/NR1I3 Antibody
(N4111) [Unconjugated ...
PP-N4111-00
CAR/NR1I3 Antibody (N4111) [Unconjugated]
(8 Publications)
Species: Hu
Applications: IHC, IP, WB
PXR/NR1I2 Antibody
(H4417) [Unconjugated ...
PP-H4417-00
PXR/NR1I2 Antibody (H4417) [Unconjugated]
(2 Publications)
Species: Hu
Applications: DirELISA, IP, WB

Publications for MGST2 Protein (NBP1-82653PEP) (0)

There are no publications for MGST2 Protein (NBP1-82653PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MGST2 Protein (NBP1-82653PEP) (0)

There are no reviews for MGST2 Protein (NBP1-82653PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for MGST2 Protein (NBP1-82653PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MGST2 Products

Blogs on MGST2

There are no specific blogs for MGST2, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Western Blot: SOD1/Cu-Zn SOD Antibody [NBP2-24915] - Human ocular fluid. Antibody at 1:1000. Western blot image submitted by a verified customer review.
SOD1/Cu-Zn SOD Antibody
NBP2-24915
Western Blot: GST Epitope Tag Antibody [NB600-326] - 0.1, 0.3, or 1.0.ug of 293 cell lysate expressing a GST-tag fusion protein. Antibody used at 0.06 ug/ml (1:15,000).
GST Epitope Tag Antibody - BSA Free
NB600-326

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our MGST2 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol MGST2