Home » MEIS2 » MEIS2 Proteins » MEIS2 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

MEIS2 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for MEIS2 Protein (NBP1-81669PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

MEIS2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MEIS2.

Source: E. coli

Amino Acid Sequence: LEKVHELCDNFCHRYISCLKGKMPIDLVIDERDGSSKSDHEELSGSSTNLADHNPSSWRDHDDATSTHSAGTPGPSSGGHASQSGDNSSEQGDGLDNSV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MEIS2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-81669.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.
Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MEIS2 Recombinant Protein Antigen

  • Meis (mouse) homolog 2
  • Meis homeobox 2
  • Meis1, myeloid ecotropic viral integration site 1 homolog 2 (mouse)
  • Meis1-related gene 1
  • MGC2820
  • myeloid ecotropic viral integration site 1 homolog 2
  • TALE homeobox protein Meis2

Background

MEIS2 encodes a homeobox protein belonging to the TALE ('three amino acid loop extension') family of homeodomain-containing proteins. TALE homeobox proteins are highly conserved transcription regulators, and several members have been shown to be essential contributors to developmental programs. Multiple transcript variants encoding distinct isoforms have been described for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MEIS1 Antibody
NBP2-24597
Immunohistochemistry-Paraffin MEIS1 Antibody
Western Blot MEIS1 Antibody
(1 Review)
Species: Ch, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
Cited-2 Antibody
(JA22) - BSA Free
NB100-136
Immunohistochemistry-Paraffin Cited-2 Antibody (JA22) - BSA Free
Western Blot Cited-2 Antibody (JA22) - BSA Free
Immunocytochemistry/ Immunofluorescence Cited-2 Antibody (JA22) - BSA Free
(14 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
PBX1 Antibody (4A2)
H00005087-M01
Western Blot PBX1 Antibody (4A2)
Immunocytochemistry/ Immunofluorescence PBX1 Antibody (4A2)
Immunohistochemistry-Paraffin PBX1 Antibody (4A2)
(12 Publications)
Species: Hu, Pm, Mu
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA, WB
Sonic Hedgehog/Shh
[Unconjugated]
464-SH
Bioactivity Sonic Hedgehog/Shh [Unconjugated]
SDS-PAGE Sonic Hedgehog/Shh [Unconjugated]
SEC-MALS Sonic Hedgehog/Shh [Unconjugated]
(68 Publications)
Species: Mu
Applications: BA
Pax6 Antibody
[Unconjugated]
AF8150
Simple Western Pax6 Antibody [Unconjugated]
Immunocytochemistry Pax6 Antibody [Unconjugated]
Western Blot Pax6 Antibody [Unconjugated]
(16 Publications)
Species: Hu
Applications: ICC, ICFlow, Simple Western, WB
FGF-8
[Unconjugated]
423-F8
SDS-PAGE FGF-8 [Unconjugated]
Bioactivity FGF-8 [Unconjugated]
Cell Culture FGF-8 [Unconjugated]
(1 Review)
(62 Publications)
Species: Hu, Mu
Applications: BA
CITED1 Antibody
(5H6)
H00004435-M03
Western Blot CITED1 Antibody (5H6)
ELISA CITED1 Antibody (5H6)
Immunohistochemistry CITED1 Antibody (5H6)
(2 Reviews)
(3 Publications)
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
CBP/KAT3A Antibody
(257003) [Unconjugate ...
MAB2676
Western Blot CBP/KAT3A Antibody (257003) [Unconjugated]
Immunocytochemistry CBP/KAT3A Antibody (257003) [Unconjugated]
(2 Publications)
Species: Hu, Mu, Rt
Applications: ICC, WB
DLX5 Antibody
NBP1-85793
Immunocytochemistry/ Immunofluorescence DLX5 Antibody
Immunohistochemistry-Paraffin DLX5 Antibody
Immunohistochemistry-Paraffin DLX5 Antibody
(3 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
ETV1 Antibody (2A8)
H00002115-M01
ELISA ETV1 Antibody (2A8)
Western Blot ETV1 Antibody (2A8)
(2 Publications)
Species: Hu
Applications: ELISA, WB
TGIF1 Antibody
(790707)
MAB7555
Simple Western TGIF1 Antibody (790707)
Western Blot TGIF1 Antibody (790707)
(1 Publication)
Species: Hu
Applications: Simple Western, WB
ALDH1A2 Antibody
NBP1-87158
Immunohistochemistry-Paraffin ALDH1A2 Antibody
Immunohistochemistry-Paraffin ALDH1A2 Antibody
Immunohistochemistry-Paraffin ALDH1A2 Antibody
(1 Review)
(4 Publications)
Species: Hu
Applications: IHC, IHC-P, Simple Western, WB
PITX2 Antibody
[Unconjugated]
AF7388
Immunohistochemistry PITX2 Antibody [Unconjugated]
(8 Publications)
Species: Hu
Applications: IHC
PDX-1/IPF1
Antibody [Unconjugate
AF2419
Western Blot PDX-1/IPF1 Antibody [Unconjugated]
Immunocytochemistry PDX-1/IPF1 Antibody [Unconjugated]
Simple Western PDX-1/IPF1 Antibody [Unconjugated]
(70 Publications)
Species: Hu
Applications: Dual ISH-IHC, ICC, IHC, Simple Western, WB
p19ARF/CDKN2A
Antibody - BSA Free
NB200-106
Immunohistochemistry p19ARF/CDKN2A Antibody - BSA Free
Western Blot p19ARF/CDKN2A Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence p19ARF/CDKN2A Antibody - BSA Free
(1 Review)
(48 Publications)
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
HOXA9 Antibody
(9X1L6)
NBP3-15720
Western Blot HOXA9 Antibody (9X1L6)
Immunohistochemistry-Paraffin HOXA9 Antibody (9X1L6)
Species: Hu, Rt
Applications: IHC, IHC-P, WB
Aldehyde
Dehydrogenase 1-A1/AL ...
AF5869
Immunocytochemistry Aldehyde Dehydrogenase 1-A1/ALDH1A1 Antibody [Unconjugated]
Immunohistochemistry Aldehyde Dehydrogenase 1-A1/ALDH1A1 Antibody [Unconjugated]
Simple Western Aldehyde Dehydrogenase 1-A1/ALDH1A1 Antibody [Unconjugated]
(9 Publications)
Species: Hu, Mu
Applications: ICC, IHC, IP, Simple Western, WB
Meis homeobox 3
Antibody (OTI3E12)
NBP2-03933
Flow Cytometry Meis homeobox 3 Antibody (OTI3E12)
Immunohistochemistry-Paraffin Meis homeobox 3 Antibody (OTI3E12)
Immunohistochemistry-Paraffin Meis homeobox 3 Antibody (OTI3E12)
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
PAG1 Antibody
(504004) [Unconjugate
MAB5285
Simple Western PAG1 Antibody (504004) [Unconjugated]
Western Blot PAG1 Antibody (504004) [Unconjugated]
(1 Publication)
Species: Hu
Applications: Simple Western, WB
Opsin 1 (Long
Wave) Antibody
NBP3-09392
Western Blot Opsin 1 (Long Wave) Antibody
Species: Hu, Mu
Applications: WB

Publications for MEIS2 Protein (NBP1-81669PEP) (0)

There are no publications for MEIS2 Protein (NBP1-81669PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MEIS2 Protein (NBP1-81669PEP) (0)

There are no reviews for MEIS2 Protein (NBP1-81669PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for MEIS2 Protein (NBP1-81669PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MEIS2 Products

Research Areas for MEIS2 Protein (NBP1-81669PEP)

Find related products by research area.

Blogs on MEIS2

There are no specific blogs for MEIS2, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our MEIS2 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol MEIS2