| Reactivity | HuSpecies Glossary |
| Applications | AC |
| Description | A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human LC3C. Source: E. coli Amino Acid Sequence: TKFLVPQELTMTQFLSIIRSRMVLRATEAF Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source | E. coli |
| Protein/Peptide Type | Recombinant Protein Antigen |
| Gene | MAP1LC3C |
| Purity | >80% by SDS-PAGE and Coomassie blue staining |
| Dilutions |
|
| Application Notes | This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57604. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW | 21 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS and 1M Urea, pH 7.4. |
| Preservative | No Preservative |
| Purity | >80% by SDS-PAGE and Coomassie blue staining |
![Immunohistochemistry ATG7 Antibody (683906) [Unconjugated]](https://images.novusbio.com/images2/ATG7_MAB6608_Immunohistochemistry_10631.jpg)
![Simple Western ATG7 Antibody (683906) [Unconjugated]](https://images.novusbio.com/images2/ATG7_MAB6608_Simple_Western_16409.jpg)
![Western Blot ATG7 Antibody (683906) [Unconjugated]](https://images.novusbio.com/images2/ATG7_MAB6608_Western_Blot_11614.jpg)
![Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Western_Blot_5930.jpg)
![Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/16332.jpg)
![Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Flow_Cytometry_8283.jpg)
Research Areas for LC3C Recombinant Protein Antigen (NBP2-57604PEP)Find related products by research area.
|
|
Read full blog post. |
|
Why LC3B Antibodies Make Ideal Autophagosomes Membrane Markers The human form of microtubule-associated protein light chain 3 (LC3) is expressed as 3 splice variants LC3A, LC3B, and LC3C.1 LC3B is a subunit of the MAP1A and MAP1B microtubule-binding proteins and plays a central role in autophagosome membrane stru... Read full blog post. |
|
Analyzing LC3 in Western blot Microtubule-associated protein light chain 3 (LC3) is considered one of the definitive markers of autophagy, and its use is widespread in labs throughout the world. Despite its popularity, there are several considerations when employing LC3 antibodies... Read full blog post. |
|
Marking the Autophagosome: the LC3 Antibody MAP1LC3 (shortened to LC3 in our antibody catalog) is one of four mammalian homologues of autophagy-related protein 8 (Atg8). It has been identified as a light chain subunit of the microtubule-associated proteins MAP1A/MAP1B. A modified form of LC3, L... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | MAP1LC3C |
![Bioactivity PDGF-AA [Unconjugated]](https://images.novusbio.com/images/protein/221-aa_recombinant-human-pdgf-aa-protein-cf-bioactivity-1410202017288.jpg)
![Cell Culture PDGF-AA [Unconjugated]](https://images.novusbio.com/images/221-aa_recombinant-human-pdgf-aa-protein-cf-cell-culture-1052024153816..jpg)
