![Western Blot: Kv3.3 Antibody (1C1) [H00003748-M01] - KCNC3 monoclonal antibody (M01), clone 1C1 Analysis of KCNC3 expression in NIH/3T3.](http://images.novusbio.com/fullsize/Kv3-3-Antibody-1C1-Western-Blot-H00003748-M01-img0005.jpg "Western Blot: Kv3.3 Antibody (1C1) [H00003748-M01] - KCNC3 monoclonal antibody (M01), clone 1C1 Analysis of KCNC3 expression in NIH/3T3.")
| Reactivity | Hu, Mu, RbSpecies Glossary |
| Applications | WB, ELISA, ICC/IF |
| Clone | 1C1 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Description | Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen | KCNC3 (NP_004968, 671 a.a. ~ 757 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ALAHEDCPAIDQPAMSPEDKSPITPGSRGRYSRDRACFLLTDYAPSPDGSIRKATGAPPLPPQDWRKPGPPSFLPDLNANAAAWISP |
| Specificity | KCNC3 (1C1) |
| Isotype | IgG1 Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | KCNC3 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF and ELISA. |
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
| Publication using H00003748-M01 | Applications | Species |
|---|---|---|
| Alaminos A, Gonzalez-Andrades M, Munoz-Avila JI et al. Volumetric and ionic regulation during the in vitro development of a corneal endothelial barrier. Exp Eye Res. 2008-02-01 [PMID: 18384772] |
Secondary Antibodies |
Isotype Controls |
Research Areas for Kv3.3 Antibody (H00003748-M01)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: Kv3.3 Antibody (1C1) [H00003748-M01] - Analysis of monoclonal antibody to KCNC3 on NIH/3T3 cell. Antibody concentration 10 ug/ml.](http://images.novusbio.com/fullsize/Kv3-3-Antibody-1C1-Immunocytochemistry-Immunofluorescence-H00003748-M01-img0004.jpg "Immunocytochemistry/Immunofluorescence: Kv3.3 Antibody (1C1) [H00003748-M01] - Analysis of monoclonal antibody to KCNC3 on NIH/3T3 cell. Antibody concentration 10 ug/ml.")
![Immunohistochemistry Potassium Channel Kv3.1 [p Ser503] Antibody](https://images.novusbio.com/images/Kv3.1-[p-Ser503]-Antibody-Immunohistochemistry-NB300-279-img0001.jpg)
![Immunohistochemistry GAD1/GAD67 Antibody [Unconjugated]](https://images.novusbio.com/images2/GAD1_AF2086_Immunohistochemistry_6730.jpg)
![Western Blot GAD1/GAD67 Antibody [Unconjugated]](https://images.novusbio.com/images2/GAD1_AF2086_Western_Blot_19950.jpg)
![Simple Western GAD1/GAD67 Antibody [Unconjugated]](https://images.novusbio.com/images2/GAD1_AF2086_Simple_Western_20168.jpg)
![Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.](https://images.novusbio.com/images/Mouse-IgG1-Kappa-Light-Chain-Isotype-Control-P3-6-2-8-1-Flow-Cytometry-NBP1-43319-img0002.jpg "Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.")