![Immunohistochemistry-Paraffin: KLF17 Antibody [NBP1-81917] - Analysis in human testis and tonsil tissues. Corresponding KLF17 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/KLF17-Antibody-Immunohistochemistry-Paraffin-NBP1-81917-img0017.jpg "Immunohistochemistry-Paraffin: KLF17 Antibody [NBP1-81917] - Analysis in human testis and tonsil tissues. Corresponding KLF17 RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: TVPSTEAQAVLPSMAQMLPPQDAHDLGMPPAESQSLLVLGSQDSLVSQPDSQEGPFLPEQPGPAPQTVEKNSRPQEGTG |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | KLF17 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | IHC reported in scientific literature (PMID: 26293300). For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP1-81917 | Applications | Species |
|---|---|---|
| Blakeley P, Fogarty NM, del Valle I et al. Defining the three cell lineages of the human blastocyst by single-cell RNA-seq. Development 2015-09-15 [PMID: 26293300] (IF/IHC, Human) | IF/IHC | Human |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | KLF17 |
![Western Blot: KLF17 Antibody [NBP1-81917] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize/KLF17-Antibody-Western-Blot-NBP1-81917-img0006.jpg "Western Blot: KLF17 Antibody [NBP1-81917] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).")
![Immunohistochemistry-Paraffin: KLF17 Antibody [NBP1-81917] - Staining of human tonsil shows low expression as expected.](http://images.novusbio.com/fullsize/KLF17-Antibody-Immunohistochemistry-Paraffin-NBP1-81917-img0011.jpg "Immunohistochemistry-Paraffin: KLF17 Antibody [NBP1-81917] - Staining of human tonsil shows low expression as expected.")
![Immunohistochemistry-Paraffin: KLF17 Antibody [NBP1-81917] - Staining of human pancreas shows no nuclear positivity in exocrine glandular cells as expected.](http://images.novusbio.com/fullsize/KLF17-Antibody-Immunohistochemistry-Paraffin-NBP1-81917-img0014.jpg "Immunohistochemistry-Paraffin: KLF17 Antibody [NBP1-81917] - Staining of human pancreas shows no nuclear positivity in exocrine glandular cells as expected.")
![Immunohistochemistry-Paraffin: KLF17 Antibody [NBP1-81917] - Staining of human skeletal muscle shows no nuclear positivity in myocytes as expected.](http://images.novusbio.com/fullsize/KLF17-Antibody-Immunohistochemistry-Paraffin-NBP1-81917-img0015.jpg "Immunohistochemistry-Paraffin: KLF17 Antibody [NBP1-81917] - Staining of human skeletal muscle shows no nuclear positivity in myocytes as expected.")
![Immunohistochemistry-Paraffin: KLF17 Antibody [NBP1-81917] - Staining of human testis shows strong nuclear positivity in spermatids.](http://images.novusbio.com/fullsize/KLF17-Antibody-Immunohistochemistry-Paraffin-NBP1-81917-img0016.jpg "Immunohistochemistry-Paraffin: KLF17 Antibody [NBP1-81917] - Staining of human testis shows strong nuclear positivity in spermatids.")
![N/A PSG1 [HRP]](https://images.novusbio.com/images2/DATA_PSG1_DPSG10_ELISA_797.jpg)
![N/A PSG1 [HRP]](https://images.novusbio.com/images2/PSG-1_DPSG10_ELISA_164.jpg)
![Western Blot ID1 Antibody [Unconjugated]](https://images.novusbio.com/images2/ID1_AF4377_Western_Blot_5453.jpg)
![Immunocytochemistry ID1 Antibody [Unconjugated]](https://images.novusbio.com/images2/ID1_AF4377_Immunocytochemistry_12849.jpg)
![Simple Western ID1 Antibody [Unconjugated]](https://images.novusbio.com/images2/af4377_human-mouse-id1-affinity-purified-polyclonal-ab-simple-western-482021152036.jpg)
![Immunohistochemistry TFF2 Antibody (366508) [Unconjugated]](https://images.novusbio.com/images2/TFF2_MAB4077_Immunohistochemistry_21485.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")