Home » KIF22 » KIF22 Proteins » KIF22 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

KIF22 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for KIF22 Recombinant Protein Antigen (NBP2-57459PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

KIF22 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human KIF22.

Source: E. coli

Amino Acid Sequence: LEPEEKAEDCWELQISPELLAHGRQKILDLLNEGSARDLRSLQRIGPKKAQLIVGWRELHGPFSQVEDLERVEGITGKQMESF

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
KIF22
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57459.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking tide related information and a protocol, click here.
Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for KIF22 Recombinant Protein Antigen

  • Kid
  • KIDA-328A3.2
  • kinesin family member 22
  • kinesin-like 4
  • Kinesin-like DNA-binding protein
  • Kinesin-like protein 4
  • kinesin-like protein KIF22
  • KNSL4kinesin-like DNA-binding protein pseudogene
  • OBP
  • OBP-1
  • OBP-2
  • origin of plasmid DNA replication-binding protein
  • oriP binding protein

Background

KIF22 is encoded by this gene is a member of kinesin-like protein family. This family of proteins are microtubule-dependent molecular motors that transport organelles within cells and move chromosomes during cell division. The C-terminal half of this protein has been shown to bind DNA. Studies with the Xenopus homolog suggests its essential role in metaphase chromosome alignment and maintenance.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

CBP/KAT3A Antibody
(257003) [Unconjugate ...
MAB2676
Western Blot CBP/KAT3A Antibody (257003) [Unconjugated]
Immunocytochemistry CBP/KAT3A Antibody (257003) [Unconjugated]
(2 Publications)
Species: Hu, Mu, Rt
Applications: ICC, WB
Connexin 26/GJB2
Antibody - BSA Free
NBP2-41304
Western Blot Connexin 26/GJB2 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence Connexin 26/GJB2 Antibody - BSA Free
Immunohistochemistry Connexin 26/GJB2 Antibody - BSA Free
(5 Publications)
Species: Hu, Po, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
CREB [p Ser133]
[Biotin]
DYC2510-2
N/A CREB [p Ser133] [Biotin]
N/A CREB [p Ser133] [Biotin]
N/A CREB [p Ser133] [Biotin]
(9 Publications)
Species: Hu, Mu, Rt
Applications: ELISA
RRM1 Antibody
(HL1231) - Azide and ...
NBP3-25643
Western Blot RRM1 Antibody (HL1231) - Azide and BSA Free
Western Blot RRM1 Antibody (HL1231) - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence RRM1 Antibody (HL1231) - Azide and BSA Free
Species: Ca, Fe, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
PAG1 Antibody
(504004) [Unconjugate
MAB5285
Simple Western PAG1 Antibody (504004) [Unconjugated]
Western Blot PAG1 Antibody (504004) [Unconjugated]
(1 Publication)
Species: Hu
Applications: Simple Western, WB
Opsin 1 (Long
Wave) Antibody
NBP3-09392
Western Blot Opsin 1 (Long Wave) Antibody
Species: Hu, Mu
Applications: WB
MCG10 Antibody -
BSA Free
NBP1-76729
Immunocytochemistry/ Immunofluorescence MCG10 Antibody - BSA Free
Western Blot MCG10 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence MCG10 Antibody - BSA Free
(2 Publications)
Species: Hu
Applications: ELISA, ICC/IF, IP, WB
KIST Antibody
(OTI2H4)
NBP2-03027
Western Blot KIST Antibody (OTI2H4)
Flow Cytometry KIST Antibody (OTI2H4)
Immunocytochemistry/ Immunofluorescence KIST Antibody (OTI2H4)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
eIF4E [p Ser209]
Antibody
NB100-81898
Western Blot eIF4E [p Ser209] Antibody
Immunocytochemistry/ Immunofluorescence eIF4E [p Ser209] Antibody
Immunohistochemistry-Paraffin eIF4E [p Ser209] Antibody
(1 Publication)
Species: Hu, Po
Applications: ICC/IF, IHC, IHC-P, WB
CDCA7L Antibody
(OTI3B5)
NBP2-46198
Western Blot CDCA7L Antibody (OTI3B5)
Immunohistochemistry CDCA7L Antibody (OTI3B5)
Immunohistochemistry CDCA7L Antibody (OTI3B5)
(1 Review)
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, WB
CD1b Antibody
(737249) [Unconjugate
MAB7446
Flow Cytometry CD1b Antibody (737249) [Unconjugated]
(1 Publication)
Species: Hu
Applications: CyTOF-ready, Flow

Azurocidin/CAP37/HBP A ...
AF2200
Azurocidin/CAP37/HBP Antibody [Unconjugated]
(3 Publications)
Species: Hu
Applications: IP, WB
STAM2 Antibody
NBP1-83289
Immunohistochemistry-Paraffin STAM2 Antibody
Immunohistochemistry-Paraffin STAM2 Antibody
Immunohistochemistry-Paraffin STAM2 Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, WB
SLBP Antibody
(2C4-1C8)
H00007884-M01
Western Blot SLBP Antibody (2C4-1C8)
Immunocytochemistry/ Immunofluorescence SLBP Antibody (2C4-1C8)
(4 Publications)
Species: Hu, Mu
Applications: ELISA, ICC/IF, WB
HDLBP Antibody -
Azide and BSA Free
NBP3-04382
Immunohistochemistry-Paraffin HDLBP Antibody - Azide and BSA Free
Immunohistochemistry-Paraffin HDLBP Antibody - Azide and BSA Free
Western Blot HDLBP Antibody - Azide and BSA Free
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
HEBP1 Antibody
NBP2-14977
Immunocytochemistry/ Immunofluorescence HEBP1 Antibody
Immunohistochemistry-Paraffin HEBP1 Antibody
Western Blot HEBP1 Antibody
(2 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
KAT3B/p300
Antibody (RW105) - BS
NB100-616
Immunocytochemistry/ Immunofluorescence KAT3B/p300 Antibody (RW105) - BSA Free
Flow Cytometry KAT3B/p300 Antibody (RW105) - BSA Free
Immunocytochemistry/ Immunofluorescence KAT3B/p300 Antibody (RW105) - BSA Free
(13 Publications)
Species: Hu, Mu, Md, Pm, Rt
Applications: ChIP, EM, Flow-IC, Flow, ICC/IF, IP, In vitro, KD, WB
KIF22 Recombinant
Protein Antigen
NBP2-57459PEP
KIF22 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for KIF22 Recombinant Protein Antigen (NBP2-57459PEP) (0)

There are no publications for KIF22 Recombinant Protein Antigen (NBP2-57459PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KIF22 Recombinant Protein Antigen (NBP2-57459PEP) (0)

There are no reviews for KIF22 Recombinant Protein Antigen (NBP2-57459PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for KIF22 Recombinant Protein Antigen (NBP2-57459PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional KIF22 Products

Research Areas for KIF22 Recombinant Protein Antigen (NBP2-57459PEP)

Find related products by research area.

Blogs on KIF22

There are no specific blogs for KIF22, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our KIF22 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol KIF22