Home » KIDINS220 » KIDINS220 Proteins » KIDINS220 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

KIDINS220 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for KIDINS220 Protein (NBP1-88995PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

KIDINS220 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human KIDINS220.

Source: E. coli

Amino Acid Sequence: EPLLEIDGDIRNFEVFLSSRTPVLVARDVKVFLPCTVNLDPKLREIIADVRAAREQISIGGLAYPPLPLHEGPPRAPSGYSQPPSVCSSTSFNGPFAGGVVS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
KIDINS220
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-88995.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for KIDINS220 Recombinant Protein Antigen

  • kinase D-interacting substrate, 220kDa

Background

KIDINS220 is a novel protein kinase D-interacting substrate of 220 kDa (Kidins220) is the first identified Protein kinase D (PKD), a serine/threonine kinase. Kidins220 is an integral membrane protein that is expressed in brain and neuroendocrine cells. Kidins220 is phosphorylated by PKD at serine 919 in vivo. Kidins220 has also been shown to function downstream of the Trks and Eph receptors.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

BDNF [HRP]
DBD00
N/A BDNF [HRP]
N/A BDNF [HRP]
N/A BDNF [HRP]
(104 Publications)
Species: Hu
Applications: ELISA
FoxO1/FKHR
Antibody (83N7F8) - B
NBP2-31376
Flow Cytometry FoxO1/FKHR Antibody (83N7F8) - BSA Free
Flow Cytometry FoxO1/FKHR Antibody (83N7F8) - BSA Free
Flow Cytometry FoxO1/FKHR Antibody (83N7F8) - BSA Free
(1 Review)
(7 Publications)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
CFTR Antibody
(24-1) [Unconjugated] ...
MAB25031
Immunohistochemistry CFTR Antibody (24-1) [Unconjugated] - C-terminus
Immunohistochemistry CFTR Antibody (24-1) [Unconjugated] - C-terminus
Immunoprecipitation CFTR Antibody (24-1) [Unconjugated] - C-terminus
(10 Reviews)
(76 Publications)
Species: Hu
Applications: IHC, IP, WB
EGFR Antibody
[Unconjugated]
AF231
Immunohistochemistry EGFR Antibody [Unconjugated]
Immunocytochemistry EGFR Antibody [Unconjugated]
Western Blot EGFR Antibody [Unconjugated]
(30 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
Pax3/Pax7 Antibody
(274212) [Unconjugate ...
MAB2457
Immunocytochemistry Pax3/Pax7 Antibody (274212) [Unconjugated]
Immunocytochemistry/ Immunofluorescence Pax3/Pax7 Antibody (274212) [Unconjugated]
(1 Review)
(19 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow, WB
TrkA Antibody
[Unconjugated]
AF1056
Immunohistochemistry TrkA Antibody [Unconjugated]
Western Blot TrkA Antibody [Unconjugated]
Immunohistochemistry TrkA Antibody [Unconjugated]
(45 Publications)
Species: Rt
Applications: IHC, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(818 Publications)
Species: Hu
Applications: BA
Pax7 Antibody
(PAX7) [Unconjugated]
MAB1675
Immunocytochemistry Pax7 Antibody (PAX7) [Unconjugated]
Immunocytochemistry Pax7 Antibody (PAX7) [Unconjugated]
Immunohistochemistry Pax7 Antibody (PAX7) [Unconjugated]
(1 Review)
(48 Publications)
Species: Ch, Hu, Mu, Rt
Applications: ICC, IHC
PKC mu Antibody
NBP1-87789
Immunocytochemistry/ Immunofluorescence PKC mu Antibody
Immunohistochemistry-Paraffin PKC mu Antibody
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Hemoglobin beta
Antibody
NBP2-14081
Immunocytochemistry/ Immunofluorescence Hemoglobin beta Antibody
Immunohistochemistry-Paraffin Hemoglobin beta Antibody
(1 Review)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MEFV Antibody
NB600-809
Immunocytochemistry/ Immunofluorescence MEFV Antibody
Flow Cytometry MEFV Antibody
(1 Publication)
Species: Hu
Applications: Flow, ICC/IF, PEP-ELISA
Glucose 6
Phosphate Dehydrogena ...
NB100-236
Immunoprecipitation Glucose 6 Phosphate Dehydrogenase Antibody
Western Blot Glucose 6 Phosphate Dehydrogenase Antibody
Western Blot Glucose 6 Phosphate Dehydrogenase Antibody
(19 Publications)
Species: Hu, Mu
Applications: IB, IHC, IHC-Fr, IP, WB
IL-10 [Biotin]
DY417
N/A IL-10 [Biotin]
(302 Publications)
Species: Mu
Applications: ELISA
SEC14L2 Antibody
(OTI4H2)
NBP2-01346
Flow Cytometry SEC14L2 Antibody (OTI4H2)
Western Blot SEC14L2 Antibody (OTI4H2)
Immunohistochemistry-Paraffin SEC14L2 Antibody (OTI4H2)
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
EphB2 Antibody
[Unconjugated]
AF467
Simple Western EphB2 Antibody [Unconjugated]
Western Blot EphB2 Antibody [Unconjugated]
Immunocytochemistry EphB2 Antibody [Unconjugated]
(5 Reviews)
(62 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
tropomyosin-3
Antibody (2E4)
H00007170-M02
Sandwich ELISA tropomyosin-3 Antibody (2E4)
Western Blot tropomyosin-3 Antibody (2E4)
Western Blot tropomyosin-3 Antibody (2E4)
(2 Publications)
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
UBL4A Antibody
(OTI1D4)
NBP2-03621
Western Blot UBL4A Antibody (OTI1D4)
Immunohistochemistry-Paraffin UBL4A Antibody (OTI1D4)
Immunocytochemistry/ Immunofluorescence UBL4A Antibody (OTI1D4)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
ERK2 Antibody
[Unconjugated]
AF1230
Western Blot ERK2 Antibody [Unconjugated]
Immunohistochemistry ERK2 Antibody [Unconjugated]
Knockout Validated ERK2 Antibody [Unconjugated]
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, WB

Publications for KIDINS220 Protein (NBP1-88995PEP) (0)

There are no publications for KIDINS220 Protein (NBP1-88995PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KIDINS220 Protein (NBP1-88995PEP) (0)

There are no reviews for KIDINS220 Protein (NBP1-88995PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for KIDINS220 Protein (NBP1-88995PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional KIDINS220 Products

Research Areas for KIDINS220 Protein (NBP1-88995PEP)

Find related products by research area.

Blogs on KIDINS220

There are no specific blogs for KIDINS220, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our KIDINS220 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol KIDINS220