![Western Blot: KCNK3 Antibody [NBP2-84108] - Host: Mouse. Target Name: KCNK3. Sample Tissue: Mouse Kidney. Antibody Dilution: 1ug/ml](http://images.novusbio.com/fullsize/KCNK3-Antibody-Western-Blot-NBP2-84108-img0002.jpg "Western Blot: KCNK3 Antibody [NBP2-84108] - Host: Mouse. Target Name: KCNK3. Sample Tissue: Mouse Kidney. Antibody Dilution: 1ug/ml")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Concentration | 1 mg/ml |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human KCNK3. Peptide sequence: TCVEQSHSSPGGGGRYSDTPSRRCLCSGAPRSAISSVSTGLHSLSTFRGL The peptide sequence for this immunogen was taken from within the described region. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | KCNK3 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 1 mg/ml |
| Purity | Protein A purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for KCNK3 Antibody (NBP2-84108)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | KCNK3 |
![Western Blot: KCNK3 Antibody [NBP2-84108] - WB Suggested Anti-KCNK3 Antibody Titration: 1.25ug/ml. ELISA Titer: 1:1562500. Positive Control: Jurkat cell lysate](http://images.novusbio.com/fullsize/KCNK3-Antibody-Western-Blot-NBP2-84108-img0001.jpg "Western Blot: KCNK3 Antibody [NBP2-84108] - WB Suggested Anti-KCNK3 Antibody Titration: 1.25ug/ml. ELISA Titer: 1:1562500. Positive Control: Jurkat cell lysate")
![Western Blot: KCNK3 Antibody [NBP2-84108] - Host: Rabbit. Target: KCNK3. Positive control (+): Hela (HL). Negative control (-): Liver tumor (T-LI). Antibody concentration: 3ug/ml](http://images.novusbio.com/fullsize/KCNK3-Antibody-Western-Blot-NBP2-84108-img0003.jpg "Western Blot: KCNK3 Antibody [NBP2-84108] - Host: Rabbit. Target: KCNK3. Positive control (+): Hela (HL). Negative control (-): Liver tumor (T-LI). Antibody concentration: 3ug/ml")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")