![Western Blot: Kallikrein 4/Prostase/EMSP1 Antibody (2A4) [H00009622-M09] - Analysis of KLK4 expression in transfected 293T cell line by KLK4 monoclonal antibody (M09), clone 2A4. Lane 1: KLK4 transfected lysate (Predicted MW: 27 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/Kallikrein-4-Prostase-EMSP1-Antibody-2A4-Western-Blot-H00009622-M09-img0002.jpg "Western Blot: Kallikrein 4/Prostase/EMSP1 Antibody (2A4) [H00009622-M09] - Analysis of KLK4 expression in transfected 293T cell line by KLK4 monoclonal antibody (M09), clone 2A4. Lane 1: KLK4 transfected lysate (Predicted MW: 27 KDa). Lane 2: Non-transfected lysate.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA |
| Clone | 2A4 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | KLK4 (NP_004908.2, 159 a.a. ~ 254 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GRMPTVLQCVNVSVVSEEVCSKLYDPLYHPSMFCAGGGQDQKDSCNGDSGGPLICNGYLQGLVSFGKAPCGQVGVPGVYTNLCKFTEWIEKTVQAS |
| Specificity | KLK4 - kallikrein 4 (prostase, enamel matrix, prostate) (2A4) |
| Isotype | IgG2a Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | KLK4 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
![Immunohistochemistry ACE/CD143 Antibody [Unconjugated]](https://images.novusbio.com/images2/ACE_AF1513_Immunohistochemistry_6703.jpg)
![Western Blot ACE/CD143 Antibody [Unconjugated]](https://images.novusbio.com/images2/ACE_AF1513_Flow_Cytometry_20028.jpg)
![Simple Western ACE/CD143 Antibody [Unconjugated]](https://images.novusbio.com/images2/ACE_AF1513_Simple_Western_20109.jpg)
| Publication using H00009622-M09 | Applications | Species |
|---|---|---|
| Halbert D, Domenyuk V, Spetzler D et al. Aptamers and uses thereof United States Patent Application US 9958448 B2 2018-01-01 |
Secondary Antibodies |
Isotype Controls |
Research Areas for Kallikrein 4/Prostase/EMSP1 Antibody (H00009622-M09)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Sandwich ELISA: Kallikrein 4/Prostase/EMSP1 Antibody (2A4) [H00009622-M09] - Detection limit for recombinant GST tagged KLK4 is 3 ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/Kallikrein-4-Prostase-EMSP1-Antibody-2A4-Sandwich-ELISA-H00009622-M09-img0001.jpg "Sandwich ELISA: Kallikrein 4/Prostase/EMSP1 Antibody (2A4) [H00009622-M09] - Detection limit for recombinant GST tagged KLK4 is 3 ng/ml as a capture antibody.")
![N/A Kallikrein 3/PSA [HRP]](https://images.novusbio.com/images2/DATA_Kallikrein_3_DKK300_ELISA_729.jpg)
![N/A Kallikrein 3/PSA [HRP]](https://images.novusbio.com/images2/DATA_Kallikrein_3_DKK300_ELISA_730.jpg)
![N/A Kallikrein 3/PSA [HRP]](https://images.novusbio.com/images2/Kallikrein_3_DKK300_ELISA_124.jpg)
![Western Blot Protein S/PROS1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Protein_S_AF4036_Western_Blot_17082.jpg)
![Simple Western Protein S/PROS1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Protein_S_AF4036_Simple_Western_18689.jpg)
