| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA, MA, AP |
| Description | A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1130-1229 of Human Jumonji/JARID2 Source: Wheat Germ (in vitro) Amino Acid Sequence: LQLETSERRCQICQHLCYLSMVVQENENVVFCLECALRHVEKQKSCRGLKLMYRYDEEQIISLVNQICGKVSGKNGSIENCLSKPTPKRGPRKRATVDVP |
| Preparation Method |
in vitro wheat germ expression system |
| Details of Functionality | This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated. |
| Source | Wheat germ |
| Protein/Peptide Type | Partial Recombinant Protein |
| Gene | JARID2 |
| Purity | >80% by SDS-PAGE and Coomassie blue staining |
| Dilutions |
|
| Theoretical MW | 36.74 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -80C. Avoid freeze-thaw cycles. |
| Buffer | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
| Preservative | No Preservative |
| Purity | >80% by SDS-PAGE and Coomassie blue staining |
Research Areas for Jumonji/JARID2 Partial Recombinant Protein (H00003720-Q01)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | JARID2 |
![Western Blot EZH2/KMT6 Antibody [Unconjugated]](https://images.novusbio.com/images2/EZH2_AF4767_Western_Blot_12571.jpg)
![Western Blot EZH2/KMT6 Antibody [Unconjugated]](https://images.novusbio.com/images/af4767_human-mouse-ezh2-affinity-purified-polyclonal-ab-4120241240516.jpg)
![Western Blot EZH2/KMT6 Antibody [Unconjugated]](https://images.novusbio.com/images/af4767_human-mouse-ezh2-affinity-purified-polyclonal-ab-4120241240219.jpg)
![Western Blot RB1 Antibody (607121) [Unconjugated]](https://images.novusbio.com/images2/RB1_MAB6495_Western_Blot_10216.jpg)
![Immunocytochemistry RB1 Antibody (607121) [Unconjugated]](https://images.novusbio.com/images2/RB1_MAB6495_Immunocytochemistry_10464.jpg)
![Simple Western RB1 Antibody (607121) [Unconjugated]](https://images.novusbio.com/images2/RB1_MAB6495_Simple_Western_16629.jpg)
![Chromatin Immunoprecipitation (ChIP) Oct-3/4 Antibody [Unconjugated]](https://images.novusbio.com/images2/Oct-3_4_AF1759_Chromatin_Immunoprecipitation_11218.jpg)
![Immunocytochemistry Oct-3/4 Antibody [Unconjugated]](https://images.novusbio.com/images2/Oct-3_4_AF1759_Immunocytochemistry_7093.jpg)
![Simple Western Oct-3/4 Antibody [Unconjugated]](https://images.novusbio.com/images2/Oct3_4_AF1759_Simple_Western_20183.jpg)
![Immunoprecipitation SUZ12 Antibody (448909) [Unconjugated]](https://images.novusbio.com/images2/SUZ12_MAB4184_Immunoprecipitation_15440.jpg)
![Western Blot SUZ12 Antibody (448909) [Unconjugated]](https://images.novusbio.com/images2/SUZ12_MAB4184_Western_Blot_12094.jpg)
![Immunocytochemistry SUZ12 Antibody (448909) [Unconjugated]](https://images.novusbio.com/images2/SUZ12_MAB4184_Immunocytochemistry__Immunofluorescence_20494.jpg)
![Knockout Validated: Jumonji/JARID2 Antibody [NB100-2214] - Jumonji/JARID2 N-terminus mediates direct interaction with H2AK119u1-modified nucleosomes. Immunoblot of nucleosomal pull downs from nuclear extract. Total nuclear extract (input) and pull down using streptavidin beads, unmodified nucleosomes or nucleosomes modified by H2AK119u1/H2AK119u1(I44A) were probed with the indicated antibodies using extracts from WT cells (left) or Jumonji/JARID2 KO mESCs (right). Image collected and cropped by CiteAb from the following publication (https://www.nature.com/articles/ncomms13661) licensed under a CC-BY license.](https://images.novusbio.com/images/Jumonji-JARID2-Antibody-Knockout-Validated-NB100-2214-img0009.jpg "Knockout Validated: Jumonji/JARID2 Antibody [NB100-2214] - Jumonji/JARID2 N-terminus mediates direct interaction with H2AK119u1-modified nucleosomes. Immunoblot of nucleosomal pull downs from nuclear extract. Total nuclear extract (input) and pull down using streptavidin beads, unmodified nucleosomes or nucleosomes modified by H2AK119u1/H2AK119u1(I44A) were probed with the indicated antibodies using extracts from WT cells (left) or Jumonji/JARID2 KO mESCs (right). Image collected and cropped by CiteAb from the following publication (https://www.nature.com/articles/ncomms13661) licensed under a CC-BY license.")