Why there are 2 dominantly expressed bands in the Western Blot? Are there 2 different constructs used for expression in the HEK cells? Has the antibody been tested with endogenous ID2?

Name: ID2 Antibody
Brand: Novus Biologicals
SKU: NBP1-88630
Price: 519 USD

Question

Accepted Answer

The ID2 overexpression lysate used for the western blot image of NBP1-88630 was NBL1-11814, which is supplied to us by a collaborator lab. As far as we know, there is only one construct expressing the ID2 protein. Since there are no bands in the negative control, we think that both bands detected in the lysate overexpressing the ID2 protein represent the target. I am sorry, but we have not investigated the identity of the two bands. Perhaps the lower band is a partially degraded version. We have received reports that NBP1-88630 has been successfully used in western blot with endogenous cell samples, although unfortunately we do not have the actual data. Nevertheless, the ICC/IF and IHC-P images for this antibody demonstrate that it can detect the endogenous protein.

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

Reactivity	Hu, Mu, RtSpecies Glossary
Applications	ICC/IF
Clonality	Polyclonal
Host	Rabbit
Conjugate	Unconjugated

Immunogen	This antibody was developed against Recombinant Protein corresponding to amino acids:MEILQHVIDYILDLQIALDSHPTIVSLHHQRPGQNQASRTPLTTLNTDISILSLQASEFPSELMSNDSKALCG
Predicted Species	Rat (97%). Backed by our 100% Guarantee.
Isotype	IgG
Clonality	Polyclonal
Host	Rabbit
Gene	ID2
Purity	Immunogen affinity purified
Innovator's Reward	Test in a species/application not listed above to receive a full credit towards a future purchase. Learn about the Innovator's Reward

Storage	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer	PBS (pH 7.2) and 40% Glycerol
Preservative	0.02% Sodium Azide
Purity	Immunogen affinity purified

Publications using NBP1-88630	Applications	Species
Liu Y, Harmelink C, Peng Y et al. CHD7 interacts with BMP R-SMADs to epigenetically regulate cardiogenesis in mice. Hum Mol Genet 2014-04-15 [PMID: 24293546] (WB, Mouse)	WB	Mouse
Harmelink C, Peng Y, DeBenedittis P et al. Myocardial Mycn is essential for mouse ventricular wall morphogenesis. Dev Biol 2013-01-01 [PMID: 23063798]

ID2 Antibody

Species Glossary

Images

Product Details

Order Details

ID2 Antibody Summary

Applications/Dilutions

Reactivity Notes

Packaging, Storage & Formulations

Alternate Names for ID2 Antibody

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for ID2 Antibody (NBP1-88630)(2)

Reviews for ID2 Antibody (NBP1-88630) (0)

Product General Protocols

Video Protocols

FAQs for ID2 Antibody (NBP1-88630). (Showing 1 - 1 of 1 FAQs).

Secondary Antibodies

Isotype Controls

Additional ID2 Products

Research Areas for ID2 Antibody (NBP1-88630)

Blogs on ID2

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Review this Product

Bioinformatics