![Western Blot: HOXB9 Antibody (4C11) [H00003219-M05] - Analysis of HOXB9 expression in transfected 293T cell line by HOXB9 monoclonal antibody (M05), clone 4C11. Lane 1: HOXB9 transfected lysatE (28.1 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/HOXB9-Antibody-4C11-Western-Blot-H00003219-M05-img0003.jpg "Western Blot: HOXB9 Antibody (4C11) [H00003219-M05] - Analysis of HOXB9 expression in transfected 293T cell line by HOXB9 monoclonal antibody (M05), clone 4C11. Lane 1: HOXB9 transfected lysatE (28.1 KDa). Lane 2: Non-transfected lysate.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA, IP, ChIP |
| Clone | 4C11 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Description | Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen | HOXB9 (NP_076922.1, 65 a.a. ~ 163 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PLSPHASGSLPSVYHPYIQPQGVPPAESRYLRTWLEPAPRGEAAPGQGQAAVKAEPLLGAPGELLKQGTPEYSLETSAGREAVLSNQRPGYGDNKICEG |
| Specificity | HOXB9 (4C11) |
| Isotype | IgG2a Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | HOXB9 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
| Publication using H00003219-M05 | Applications | Species |
|---|---|---|
| Wu SY, Rupaimoole R, Shen F et al. A miR-192-EGR1-HOXB9 regulatory network controls the angiogenic switch in cancer. Nat Commun 2016-04-04 [PMID: 27041221] (WB) | WB |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Western Blot: HOXB9 Antibody (4C11) [H00003219-M05] - Analysis of HOXB9 transfected lysate using anti-HOXB9 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with HOXB9 rabbit polyclonal antibody.](http://images.novusbio.com/fullsize/HOXB9-Antibody-4C11-Western-Blot-H00003219-M05-img0002.jpg "Western Blot: HOXB9 Antibody (4C11) [H00003219-M05] - Analysis of HOXB9 transfected lysate using anti-HOXB9 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with HOXB9 rabbit polyclonal antibody.")
![Sandwich ELISA: HOXB9 Antibody (4C11) [H00003219-M05] - Detection limit for recombinant GST tagged HOXB9 is 3 ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/HOXB9-Antibody-4C11-Sandwich-ELISA-H00003219-M05-img0001.jpg "Sandwich ELISA: HOXB9 Antibody (4C11) [H00003219-M05] - Detection limit for recombinant GST tagged HOXB9 is 3 ng/ml as a capture antibody.")
![SDS-PAGE ErbB2/Her2 [Unconjugated]](https://images.novusbio.com/images2/ErbB2_1129-ER_70.jpg)
![Bioactivity ErbB2/Her2 [Unconjugated]](https://images.novusbio.com/images2/1129-er_recombinant-human-erbb2-her2-fc-chimera-protein-cf-bioactivity-7122020142841.jpg)
