![Western Blot: Histone Deacetylase 8/HDAC8 Antibody (1O2Y5) [NBP3-16713] - Analysis of extracts of various cell lines, using Histone Deacetylase 8/HDAC8 Rabbit mAb (NBP3-16713) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.](http://images.novusbio.com/fullsize/Histone-Deacetylase-8-HDAC8-Antibody-1O2Y5-Western-Blot-NBP3-16713-img0007.jpg "Western Blot: Histone Deacetylase 8/HDAC8 Antibody (1O2Y5) [NBP3-16713] - Analysis of extracts of various cell lines, using Histone Deacetylase 8/HDAC8 Rabbit mAb (NBP3-16713) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC, IP, KO |
| Clone | 1O2Y5 |
| Clonality | Monoclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Additional Information | Recombinant Monoclonal Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Histone Deacetylase 8/HDAC8 (Q9BY41). MEEPEEPADSGQSLVPVYIYSPEYVSMCDSLAKIPKRASMVHSLIEAYALHKQMRIVKPKVASMEEMATFHTDAYLQHLQKVSQEGDDDHPDSIEYGLGY |
| Isotype | IgG |
| Clonality | Monoclonal |
| Host | Rabbit |
| Gene | HDAC8 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS, 0.05% BSA, 50% glycerol, pH7.3 |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for Histone Deacetylase 8/HDAC8 Antibody (NBP3-16713)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | HDAC8 |
![Immunocytochemistry/Immunofluorescence: Histone Deacetylase 8/HDAC8 Antibody (1O2Y5) [NBP3-16713] - Immunofluorescence analysis of NIH-3T3 cells using Histone Deacetylase 8/HDAC8 Rabbit mAb (NBP3-16713) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/Histone-Deacetylase-8-HDAC8-Antibody-1O2Y5-Immunocytochemistry-Immunofluorescence-NBP3-16713-img0005.jpg "Immunocytochemistry/Immunofluorescence: Histone Deacetylase 8/HDAC8 Antibody (1O2Y5) [NBP3-16713] - Immunofluorescence analysis of NIH-3T3 cells using Histone Deacetylase 8/HDAC8 Rabbit mAb (NBP3-16713) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.")
![Immunohistochemistry-Paraffin: Histone Deacetylase 8/HDAC8 Antibody (1O2Y5) [NBP3-16713] - Mouse testis using Histone Deacetylase 8/HDAC8 Rabbit mAb (NBP3-16713) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/Histone-Deacetylase-8-HDAC8-Antibody-1O2Y5-Immunohistochemistry-Paraffin-NBP3-16713-img0004.jpg "Immunohistochemistry-Paraffin: Histone Deacetylase 8/HDAC8 Antibody (1O2Y5) [NBP3-16713] - Mouse testis using Histone Deacetylase 8/HDAC8 Rabbit mAb (NBP3-16713) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.")
![Western Blot: Histone Deacetylase 8/HDAC8 Antibody (1O2Y5) [NBP3-16713] - Analysis of extracts of various cell lines, using Histone Deacetylase 8/HDAC8 Rabbit mAb (NBP3-16713) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.](http://images.novusbio.com/fullsize/Histone-Deacetylase-8-HDAC8-Antibody-1O2Y5-Western-Blot-NBP3-16713-img0006.jpg "Western Blot: Histone Deacetylase 8/HDAC8 Antibody (1O2Y5) [NBP3-16713] - Analysis of extracts of various cell lines, using Histone Deacetylase 8/HDAC8 Rabbit mAb (NBP3-16713) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.")
![Immunohistochemistry-Paraffin: Histone Deacetylase 8/HDAC8 Antibody (1O2Y5) [NBP3-16713] - Rat brain using Histone Deacetylase 8/HDAC8 Rabbit mAb (NBP3-16713) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/Histone-Deacetylase-8-HDAC8-Antibody-1O2Y5-Immunohistochemistry-Paraffin-NBP3-16713-img0002.jpg "Immunohistochemistry-Paraffin: Histone Deacetylase 8/HDAC8 Antibody (1O2Y5) [NBP3-16713] - Rat brain using Histone Deacetylase 8/HDAC8 Rabbit mAb (NBP3-16713) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.")
![Immunohistochemistry-Paraffin: Histone Deacetylase 8/HDAC8 Antibody (1O2Y5) [NBP3-16713] - Human liver cancer using Histone Deacetylase 8/HDAC8 Rabbit mAb (NBP3-16713) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/Histone-Deacetylase-8-HDAC8-Antibody-1O2Y5-Immunohistochemistry-Paraffin-NBP3-16713-img0003.jpg "Immunohistochemistry-Paraffin: Histone Deacetylase 8/HDAC8 Antibody (1O2Y5) [NBP3-16713] - Human liver cancer using Histone Deacetylase 8/HDAC8 Rabbit mAb (NBP3-16713) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.")
![Knockout Validated: Histone Deacetylase 8/HDAC8 Antibody (1O2Y5) [NBP3-16713] - Western blot analysis of extracts from normal (control) and Histone Deacetylase 8/HDAC8 knockout (KO) 293T cells, using Histone Deacetylase 8/HDAC8 antibody (NBP3-16713) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.](http://images.novusbio.com/fullsize/Histone-Deacetylase-8-HDAC8-Antibody-1O2Y5-Knockout-Validated-NBP3-16713-img0001.jpg "Knockout Validated: Histone Deacetylase 8/HDAC8 Antibody (1O2Y5) [NBP3-16713] - Western blot analysis of extracts from normal (control) and Histone Deacetylase 8/HDAC8 knockout (KO) 293T cells, using Histone Deacetylase 8/HDAC8 antibody (NBP3-16713) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.")
![Immunoprecipitation: Histone Deacetylase 8/HDAC8 Antibody (1O2Y5) [NBP3-16713] - Analysis of 300ug extracts of HeLa cells using 3ug Histone Deacetylase 8/HDAC8 antibody (NBP3-16713). Western blot was performed from the immunoprecipitate using Histone Deacetylase 8/HDAC8 antibody (NBP3-16713) at a dilition of 1:1000.](http://images.novusbio.com/fullsize/Histone-Deacetylase-8-HDAC8-Antibody-1O2Y5-Immunoprecipitation-NBP3-16713-img0008.jpg "Immunoprecipitation: Histone Deacetylase 8/HDAC8 Antibody (1O2Y5) [NBP3-16713] - Analysis of 300ug extracts of HeLa cells using 3ug Histone Deacetylase 8/HDAC8 antibody (NBP3-16713). Western blot was performed from the immunoprecipitate using Histone Deacetylase 8/HDAC8 antibody (NBP3-16713) at a dilition of 1:1000.")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")