Novus Biologicals products are now on bio-techne.com

HESX1 Recombinant Protein Antigen

Name: HESX1 Recombinant Protein Antigen
Brand: Novus Biologicals
SKU: NBP1-89090PEP
Price: 279 USD

Images

There are currently no images for HESX1 Protein (NBP1-89090PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary

Reactivity	HuSpecies Glossary
Applications	AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

HESX1 Recombinant Protein Antigen Summary

Description	A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HESX1. Source: E. coli Amino Acid Sequence: QLGENKPSTCSFSIERILGLDQKKDCVPLMKPHRPWADTCSSSGKDGNLCLHVPNPPSGISFPSVVDHPMPEERASKYENYFSASERLSLKRELSWYRGRRPRTAFTQNQIEVLENVFRVNCYPG Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source	E. coli
Protein/Peptide Type	Recombinant Protein Antigen
Gene	HESX1
Purity	>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions	Antibody Competition 10 - 100 molar excess
Application Notes	This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89090. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com For further blocking peptide related information and a protocol, click here.
Theoretical MW	32 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage	Store at -20C. Avoid freeze-thaw cycles.
Buffer	PBS and 1M Urea, pH 7.4.
Preservative	No Preservative
Purity	>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for HESX1 Recombinant Protein Antigen

CPHD5
hAnf
HESX homeobox 1
homeobox expressed in ES cells 1
Homeobox protein ANF
MGC138294
Rathke pouch homeobox
RPXES cell expressed 1

Background

HESX1 encodes a conserved homeobox protein that is a transcriptional repressor in the developing forebrain and pituitary gland. Mutations in this gene are associated with septooptic dysplasia, HESX1-related growth hormone deficiency, and combined pituitary hormone deficiency. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Renin Antibody
(411507) - Propeptide

MAB4447

(6 Publications)

Species: Hu

Applications: IHC, WB

Serpin
A8/Angiotensinogen An ...

NBP1-30027

Western Blot Serpin A8/Angiotensinogen Antibody - BSA Free

(11 Publications)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, WB

Neurophysin
II/Arg-vasopressin An ...

AF009

Species: Hu

Applications: IHC, WB

preproANP Antibody

NBP2-14873

(6 Publications)

Species: Hu, Mu, Rt

Applications: IHC, IHC-P, WB

POMC Antibody

NB100-1533

(10 Publications)

Species: Hu, Mu, Po, Rt, Sh

Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB

Neprilysin/CD10
Antibody [Unconjugate

AF1126

Western Blot Neprilysin/CD10 Antibody [Unconjugated]

(22 Publications)

Species: Mu

Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB

NT-proBNP Antibody
(OTI11G4)

NBP2-46201

Immunohistochemistry NT-proBNP Antibody (OTI11G4)

(1 Review)

Species: Hu

Applications: IHC, IHC-P, WB

RAPGEF5 Antibody

NBP2-57362

Immunocytochemistry/ Immunofluorescence RAPGEF5 Antibody

Species: Hu

Applications: ICC/IF, WB

NLRP3/NALP3
Antibody - BSA Free

NBP2-12446

(4 Reviews)

(230 Publications)

Species: Hu, Mu, Rt

Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IM, IP, KD, WB

IFN-alpha/beta R1
Antibody [Unconjugate ...

AF245

(9 Publications)

Species: Hu

Applications: CyTOF-ready, Flow, WB

Pit1 Antibody

NBP1-92273

(17 Publications)

Species: Hu, Mu

Applications: IHC, IHC-P

ACE/CD143 Antibody
[Unconjugated]

AF1513

Western Blot ACE/CD143 Antibody [Unconjugated]

Simple Western ACE/CD143 Antibody [Unconjugated]

(1 Review)

(7 Publications)

Species: Mu

Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB

Angiogenin [HRP]

DAN00

(23 Publications)

Species: Hu

Applications: ELISA

PROP1 Antibody

NBP3-10488

Species: Hu

Applications: WB

Nucleostemin
Antibody [Unconjugate

AF1638

Simple Western Nucleostemin Antibody [Unconjugated]

Western Blot Nucleostemin Antibody [Unconjugated]

(9 Publications)

Species: Hu, Mu, Rt

Applications: ICC, Simple Western, WB

Endothelin-1 [HRP]

QET00B

(44 Publications)

Species: Hu

Applications: ELISA

S100A6 Antibody

NBP1-89388

Immunocytochemistry/ Immunofluorescence S100A6 Antibody

Immunohistochemistry-Paraffin S100A6 Antibody

(7 Publications)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, WB

HESX1 Recombinant
Protein Antigen

NBP1-89090PEP

Species: Hu

Applications: AC

Publications for HESX1 Protein (NBP1-89090PEP) (0)

There are no publications for HESX1 Protein (NBP1-89090PEP).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HESX1 Protein (NBP1-89090PEP) (0)

There are no reviews for HESX1 Protein (NBP1-89090PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for HESX1 Protein (NBP1-89090PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional HESX1 Products

Blogs on HESX1

There are no specific blogs for HESX1, but you can read our latest blog posts.

Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

NLRP3/NALP3 Antibody - BSA Free
NBP2-12446

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

Mass

Concentration

Volume

Molecular Weight* g/mol

Review this Product

Be the first to review our HESX1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol

HESX1

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Help Finding Antibodies Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

HESX1 Recombinant Protein Antigen

Species Glossary

Images

Product Details

Order Details

HESX1 Recombinant Protein Antigen Summary

Applications/Dilutions

Packaging, Storage & Formulations

Alternate Names for HESX1 Recombinant Protein Antigen

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for HESX1 Protein (NBP1-89090PEP) (0)

Reviews for HESX1 Protein (NBP1-89090PEP) (0)

FAQs for HESX1 Protein (NBP1-89090PEP) (0)

Additional HESX1 Products

Blogs on HESX1

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Molarity Calculator

Review this Product

Bioinformatics