![Western Blot: HES7 Antibody [NBP2-85042] - WB Suggested Anti-HES7 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: Human heart](http://images.novusbio.com/fullsize/HES7-Antibody-Western-Blot-NBP2-85042-img0003.jpg "Western Blot: HES7 Antibody [NBP2-85042] - WB Suggested Anti-HES7 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: Human heart")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Concentration | 0.5 mg/ml |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human HES7. Peptide sequence: VGYLRERSRVEPPGVPRSPVQDAKALASCYLSGFRECLLRLAAIAHDASP The peptide sequence for this immunogen was taken from within the described region. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | HES7 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 0.5 mg/ml |
| Purity | Affinity purified |
![Immunocytochemistry HES-4 Antibody [Unconjugated]](https://images.novusbio.com/images2/HES4_AF3600_Immunocytochemistry__Immunofluorescence_19235.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | HES7 |
![Immunohistochemistry-Paraffin: HES7 Antibody [NBP2-85042] - Rabbit Anti-HES7 Antibody. Paraffin Embedded Tissue: Human Pancreas. Cellular Data: Epithelial cells of pancreatic acinus. Antibody Concentration: 4.0-8.0 ug/ml. Magnification: 400X](http://images.novusbio.com/fullsize/HES7-Antibody-Immunohistochemistry-Paraffin-NBP2-85042-img0002.jpg "Immunohistochemistry-Paraffin: HES7 Antibody [NBP2-85042] - Rabbit Anti-HES7 Antibody. Paraffin Embedded Tissue: Human Pancreas. Cellular Data: Epithelial cells of pancreatic acinus. Antibody Concentration: 4.0-8.0 ug/ml. Magnification: 400X")
![Western Blot: HES7 Antibody [NBP2-85042] - Host: Rabbit. Target Name: HES7. Sample Tissue: Human 293T Whole Cell. Antibody Dilution: 1ug/ml](http://images.novusbio.com/fullsize/HES7-Antibody-Western-Blot-NBP2-85042-img0004.jpg "Western Blot: HES7 Antibody [NBP2-85042] - Host: Rabbit. Target Name: HES7. Sample Tissue: Human 293T Whole Cell. Antibody Dilution: 1ug/ml")
![Immunohistochemistry-Paraffin: HES7 Antibody [NBP2-85042] - Rabbit Anti-HES7 Antibody. Paraffin Embedded Tissue: Human Kidney. Cellular Data: Epithelial cells of renal tubule. Antibody Concentration: 4.0-8.0 ug/ml. Magnification: 400X](http://images.novusbio.com/fullsize/HES7-Antibody-Immunohistochemistry-Paraffin-NBP2-85042-img0001.jpg "Immunohistochemistry-Paraffin: HES7 Antibody [NBP2-85042] - Rabbit Anti-HES7 Antibody. Paraffin Embedded Tissue: Human Kidney. Cellular Data: Epithelial cells of renal tubule. Antibody Concentration: 4.0-8.0 ug/ml. Magnification: 400X")
![SDS-PAGE FGF-8 [Unconjugated]](https://images.novusbio.com/images2/FGF-8_423-F8_332.jpg)
![Bioactivity FGF-8 [Unconjugated]](https://images.novusbio.com/images2/FGF8_423F8_1438.jpg)
![Cell Culture FGF-8 [Unconjugated]](https://images.novusbio.com/images/423-f8_recombinant-human-mouse-fgf-8b-protein-cell-culture-1052024145159..jpg)
![Immunohistochemistry DLL1 Antibody [Unconjugated]](https://images.novusbio.com/images2/DLL1_AF3970_Immunohistochemistry_6817.jpg)
![Flow Cytometry DLL1 Antibody [Unconjugated]](https://images.novusbio.com/images2/DLL1_AF3970_Flow_Cytometry_9303.jpg)
![Immunocytochemistry/ Immunofluorescence DLL1 Antibody [Unconjugated]](https://images.novusbio.com/images/af3970_mouse-rat-dll1-affinity-purified-polyclonal-ab-41202412403596.jpg)
![Bioactivity Wnt-3a [Unconjugated]](https://images.novusbio.com/images2/Wnt3a_5036WN_2880.jpg)
![Bioactivity Wnt-3a [Unconjugated]](https://images.novusbio.com/images2/5036-wn_recombinant-human-wnt-3a-protein-bioactivity-3112023115329.jpg)
![Cell Culture Wnt-3a [Unconjugated]](https://images.novusbio.com/images/5036-wn_recombinant-human-wnt-3a-protein-bioactivity-252023103514.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")