![Western Blot: HERV Antibody [NBP2-86666] - Host: Rabbit. Target Name: ERVW-1. Sample Type: HT1080 Whole Cell lysates. Antibody Dilution: 1.0ug/ml](http://images.novusbio.com/fullsize/HERV-Antibody-Western-Blot-NBP2-86666-img0001.jpg "Western Blot: HERV Antibody [NBP2-86666] - Host: Rabbit. Target Name: ERVW-1. Sample Type: HT1080 Whole Cell lysates. Antibody Dilution: 1.0ug/ml")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Concentration | 0.5 mg/ml |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human HERV. Peptide sequence: CMTSSSPYQEFLWRMQRPGNIDAPSYRSLSKGTPTFTAHTHMPRNCYHSA The peptide sequence for this immunogen was taken from within the described region. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ERVW-1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 0.5 mg/ml |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for HERV Antibody (NBP2-86666)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ERVW-1 |
![Western Blot: HERV Antibody [NBP2-86666] - Host: Rabbit. Target: ERVW-1. Positive control (+): Human Placenta (PL). Negative control (-): 293T (2T). Antibody concentration: 1ug/ml](http://images.novusbio.com/fullsize/HERV-Antibody-Western-Blot-NBP2-86666-img0002.jpg "Western Blot: HERV Antibody [NBP2-86666] - Host: Rabbit. Target: ERVW-1. Positive control (+): Human Placenta (PL). Negative control (-): 293T (2T). Antibody concentration: 1ug/ml")
![Immunohistochemistry CD55/DAF Antibody [Unconjugated]](https://images.novusbio.com/images2/CD55_AF2009_Immunohistochemistry_6728.jpg)
![Immunocytochemistry CD55/DAF Antibody [Unconjugated]](https://images.novusbio.com/images2/CD55_AF2009_Immunocytochemistry__Immunofluorescence_23052.jpg)
![Flow Cytometry CCR5 Antibody (45531) [Unconjugated]](https://images.novusbio.com/images2/CCR5_MAB182_Flow_Cytometry_22407.jpg)
![Neutralization CCR5 Antibody (45531) [Unconjugated]](https://images.novusbio.com/images2/CCR5_MAB182_Block_Neutralize_9044.jpg)
![Immunocytochemistry CCR5 Antibody (45531) [Unconjugated]](https://images.novusbio.com/images2/CCR5_MAB182_Immunocytochemistry_9681.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
