Novus Biologicals products are now on bio-techne.com

Recombinant Human GRIP1 GST (N-Term) Protein

Name: Recombinant Human GRIP1 GST (N-Term) Protein
Brand: Novus Biologicals
SKU: H00023426-Q01
Price: 569 USD

Submit a Review

Images

(

Enlarge)

12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary

Reactivity	HuSpecies Glossary
Applications	WB, ELISA, MA, AP

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Recombinant Human GRIP1 GST (N-Term) Protein Summary

Description	A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 851-950 of Human GRIP1 Source: Wheat Germ (in vitro) Amino Acid Sequence: QSGILRELEATIMSGSTMSLNHEAPTPRSQLGRQASFQERSSSRPHYSQTTRSNTLPSDVGRKSVTLRKMKQEIKEIMSPTPVELHKVTLYKDSDMEDFG
Preparation Method	in vitro wheat germ expression system
Details of Functionality	This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source	Wheat germ
Protein/Peptide Type	Partial Recombinant Protein
Gene	GRIP1
Purity	>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions	ELISA Immunoaffinity Purification Protein Array Western Blot
Theoretical MW	36.74 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage	Store at -80C. Avoid freeze-thaw cycles.
Buffer	50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative	No Preservative
Purity	>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human GRIP1 GST (N-Term) Protein

glutamate receptor interacting protein 1
glutamate receptor-interacting protein 1
GRIP
GRIP-1

Background

GRIP1 - glutamate receptor interacting protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

PINCH1/LIMS1
Antibody (591604)

MAB6257

(1 Publication)

Species: Hu, Mu, Rt

Applications: WB

NCOA2 Antibody

NB100-1756

Immunocytochemistry/ Immunofluorescence NCOA2 Antibody

(1 Review)

(4 Publications)

Species: Hu, Mu

Applications: ICC/IF, IHC, IHC-P, WB

C-Reactive
Protein/CRP [Biotin]

DY1707

(66 Publications)

Species: Hu

Applications: ELISA

Dystrophin Antibody

NBP1-89953

(4 Publications)

Species: Hu, Mu

Applications: ICC/IF, IHC, IHC-P

ER alpha/NR3A1
Antibody (33)

NB300-560

Immunohistochemistry-Frozen ER alpha/NR3A1 Antibody (33)

Immunohistochemistry-Paraffin ER alpha/NR3A1 Antibody (33)

(1 Review)

(10 Publications)

Species: Av, Bv, Ma, Hu, Mu, Pm, Rt

Applications: IF, IHC, IHC-Fr, IHC-P, WB

ARC/ARG3.1 Antibody

NBP1-56929

(2 Publications)

Species: Hu

Applications: IHC, IHC-P, WB

ARC/NOL3 Antibody

NBP2-19561

Immunohistochemistry-Frozen ARC/NOL3 Antibody

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB

Bestrophin 1
Antibody (E6-6) - BSA

NB300-164

Immunohistochemistry-Paraffin Bestrophin 1 Antibody (E6-6) - BSA Free

(1 Review)

(49 Publications)

Species: Ca, Hu, Mu, Po, Pm, Rt(-)

Applications: Dual ISH-IHC, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO, PLA, WB

GluR2 Antibody
(JU20-43)

NBP2-75510

Immunohistochemistry-Paraffin GluR2 Antibody (JU20-43)

(2 Publications)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, IP, WB

alpha-Sarcoglycan
Antibody (JA51-81)

NBP2-67150

Immunohistochemistry-Frozen alpha-Sarcoglycan Antibody (JA51-81)

(1 Review)

Species: Hu, Mu, Rt

Applications: IHC, IHC-Fr, IHC-P, IP, WB

NCOA3/AIB1 Antibody

NB100-314

(1 Review)

(4 Publications)

Species: Hu

Applications: IP, WB

IL-6 [HRP]

M6000B

(636 Publications)

Species: Mu

Applications: ELISA

WIRE Antibody

NBP1-86856

Immunohistochemistry-Paraffin WIRE Antibody

(3 Publications)

Species: Hu, Mu, Rt

Applications: IHC, IHC-P, WB

mGluR2 Antibody -
BSA Free

NLS892

Species: Bt, Bv, Ca, Ha, Hu, Mu, Po, Rb, Rt

Applications: ICC, IHC, IHC-P, WB

PICK1 Antibody

NB100-41403

Immunohistochemistry-Paraffin PICK1 Antibody

(2 Publications)

Species: Hu, Mu, Rt

Applications: IHC, IHC-P, PEP-ELISA, WB

TNF-alpha
[Unconjugated]

210-TA

(3 Reviews)

(803 Publications)

Species: Hu

Applications: BA

SRC1 Antibody
(1135)

NB200-310

(1 Review)

(4 Publications)

Species: Hu, Pm, Mu, Rt

Applications: ChIP, IP, WB

Albumin Antibody
(188835) [Unconjugate ...

MAB1455

Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum

Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum

(3 Reviews)

(54 Publications)

Species: Hu

Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB

IGF-I/IGF-1
[Unconjugated]

291-G1

Mass Spectrometry IGF-I/IGF-1 [Unconjugated]

(217 Publications)

Species: Hu

Applications: BA

Recombinant Human
GRIP1 GST (N-Term) Pr ...

H00023426-Q01

Species: Hu

Applications: WB, ELISA, MA, AP

Publications for GRIP1 Partial Recombinant Protein (H00023426-Q01) (0)

There are no publications for GRIP1 Partial Recombinant Protein (H00023426-Q01).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GRIP1 Partial Recombinant Protein (H00023426-Q01) (0)

There are no reviews for GRIP1 Partial Recombinant Protein (H00023426-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GRIP1 Partial Recombinant Protein (H00023426-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GRIP1 Products

Research Areas for GRIP1 Partial Recombinant Protein (H00023426-Q01)

Find related products by research area.

Blogs on GRIP1

There are no specific blogs for GRIP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.

TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Review this Product

Be the first to review our Recombinant Human GRIP1 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol

GRIP1

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Help Finding Antibodies Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

Recombinant Human GRIP1 GST (N-Term) Protein

Species Glossary

Images

Product Details

Order Details

Recombinant Human GRIP1 GST (N-Term) Protein Summary

Applications/Dilutions

Packaging, Storage & Formulations

Notes

Alternate Names for Recombinant Human GRIP1 GST (N-Term) Protein

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for GRIP1 Partial Recombinant Protein (H00023426-Q01) (0)

Reviews for GRIP1 Partial Recombinant Protein (H00023426-Q01) (0)

Product General Protocols

Video Protocols

FAQs for GRIP1 Partial Recombinant Protein (H00023426-Q01) (0)

Additional GRIP1 Products

Research Areas for GRIP1 Partial Recombinant Protein (H00023426-Q01)

Blogs on GRIP1

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Review this Product

Bioinformatics