![Western Blot: GPSM1 Antibody [H00026086-B01P] - Analysis of GPSM1 expression in rat brain.](http://images.novusbio.com/fullsize/GPSM1-Antibody-Western-Blot-H00026086-B01P-img0001.jpg "Western Blot: GPSM1 Antibody [H00026086-B01P] - Analysis of GPSM1 expression in rat brain.")
| Reactivity | Hu, RtSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | GPSM1 (AAH48343.1, 1 a.a. - 166 a.a.) full-length human protein. MDDQRCPLDDGQAGAAEATAAPTLEDRIAQPSMTASPQTEEFFDLIASSQSRRLDDQRASVGSLPGLRITHSNAGHLRGHGEPQEPGDDFFNMLIKYQSSRIDDQRCPPPDVLPRGPTMPDEDFFSLIQRVQAKRMDEQRVDLAGGPEQGAGGPPEPQQQCQPGAS |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Mouse |
| Gene | GPSM1 |
| Purity | Protein G purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | Protein G purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for GPSM1 Antibody (H00026086-B01P)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | GPSM1 |
| Uniprot |
|
![Western Blot: GPSM1 Antibody [H00026086-B01P] - Analysis of GPSM1 expression in transfected 293T cell line by GPSM1 polyclonal antibody. Lane 1: GPSM1 transfected lysate(18.26 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/GPSM1-Antibody-Western-Blot-H00026086-B01P-img0002.jpg "Western Blot: GPSM1 Antibody [H00026086-B01P] - Analysis of GPSM1 expression in transfected 293T cell line by GPSM1 polyclonal antibody. Lane 1: GPSM1 transfected lysate(18.26 KDa). Lane 2: Non-transfected lysate.")
![Immunohistochemistry Notch-2 Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af3735_human-notch-2-intracellular-domain-affinity-purified-pab-immunohistochemistry-1862024111356..jpg)
![Western Blot SOS2 Antibody [Unconjugated]](https://images.novusbio.com/images2/SOS2_AF6260_Western_Blot_9542.jpg)
![Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]](https://images.novusbio.com/images/Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP1-97019-img0004.jpg "Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]")