![Western Blot: GNB5 Antibody (3A3) [H00010681-M01] - Analysis of GNB5 expression in transfected 293T cell line by GNB5 monoclonal antibody (M01), clone 3A3.Lane 1: GNB5 transfected lysate(38.8 KDa).Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/GNB5-Antibody-3A3-Western-Blot-H00010681-M01-img0003.jpg "Western Blot: GNB5 Antibody (3A3) [H00010681-M01] - Analysis of GNB5 expression in transfected 293T cell line by GNB5 monoclonal antibody (M01), clone 3A3.Lane 1: GNB5 transfected lysate(38.8 KDa).Lane 2: Non-transfected lysate.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA, Func |
| Clone | 3A3 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | GNB5 (NP_057278, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MCDQTFLVNVFGSCDKCFKQRALRPVFKKSQQLSYCSTCAEIMATEGLHENETLASLKSEAESLKGKLEEERAKLHDVELHQVAERVEAL |
| Specificity | GNB5 (3A3) |
| Isotype | IgG1 Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | GNB5 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for GNB5 Antibody (H00010681-M01)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Proximity Ligation Assay: GNB5 Antibody (3A3) [H00010681-M01] - Analysis of protein-protein interactions between GNG7 and GNB5. HeLa cells were stained with anti-GNG7 rabbit purified polyclonal 1:1200 and anti-GNB5 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).](http://images.novusbio.com/fullsize/GNB5-Antibody-3A3-Proximity-Ligation-Assay-H00010681-M01-img0001.jpg "Proximity Ligation Assay: GNB5 Antibody (3A3) [H00010681-M01] - Analysis of protein-protein interactions between GNG7 and GNB5. HeLa cells were stained with anti-GNG7 rabbit purified polyclonal 1:1200 and anti-GNB5 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).")
![Sandwich ELISA: GNB5 Antibody (3A3) [H00010681-M01] - Detection limit for recombinant GST tagged GNB5 is 0.1 ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/GNB5-Antibody-3A3-Sandwich-ELISA-H00010681-M01-img0002.jpg "Sandwich ELISA: GNB5 Antibody (3A3) [H00010681-M01] - Detection limit for recombinant GST tagged GNB5 is 0.1 ng/ml as a capture antibody.")
![SDS-PAGE LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_719.jpg)
![Bioactivity LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_721.jpg)
![Flow Cytometry Lgr6 Antibody (918719) [Unconjugated]](https://images.novusbio.com/images2/Lgr6_MAB8458_Flow_Cytometry_16097.jpg)
![Immunocytochemistry Lgr6 Antibody (918719) [Unconjugated]](https://images.novusbio.com/images2/Lgr6_MAB8458_Immunocytochemistry_16415.jpg)
![Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.](https://images.novusbio.com/images/Mouse-IgG1-Kappa-Light-Chain-Isotype-Control-P3-6-2-8-1-Flow-Cytometry-NBP1-43319-img0002.jpg "Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.")