![Western Blot: GlyT2/SLC6A5 Antibody [NBP2-86653] - Host: Rabbit. Target Name: SLC6A5. Sample Type: COLO205 Whole cell lysates. Antibody Dilution: 1.0ug/ml](http://images.novusbio.com/fullsize/GlyT2-SLC6A5-Antibody-Western-Blot-NBP2-86653-img0002.jpg "Western Blot: GlyT2/SLC6A5 Antibody [NBP2-86653] - Host: Rabbit. Target Name: SLC6A5. Sample Type: COLO205 Whole cell lysates. Antibody Dilution: 1.0ug/ml")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Concentration | 0.5 mg/ml |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of human GlyT2/SLC6A5. Peptide sequence: KNSTFCMTAYPNVTMVNFTSQANKTFVSGSEEYFKYFVLKISAGIEYPGE The peptide sequence for this immunogen was taken from within the described region. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SLC6A5 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 0.5 mg/ml |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for GlyT2/SLC6A5 Antibody (NBP2-86653)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SLC6A5 |
![Immunohistochemistry-Paraffin: GlyT2/SLC6A5 Antibody [NBP2-86653] - Rabbit Anti-SLC6A5 Antibody. Formalin Fixed Paraffin Embedded Tissue: Human Adult heart. Observed Staining: Cytoplasmic. Primary Antibody Concentration: 1:600. Secondary Antibody: Donkey anti-Rabbit-Cy2/3. Secondary Antibody](http://images.novusbio.com/fullsize/GlyT2-SLC6A5-Antibody-Immunohistochemistry-Paraffin-NBP2-86653-img0001.jpg "Immunohistochemistry-Paraffin: GlyT2/SLC6A5 Antibody [NBP2-86653] - Rabbit Anti-SLC6A5 Antibody. Formalin Fixed Paraffin Embedded Tissue: Human Adult heart. Observed Staining: Cytoplasmic. Primary Antibody Concentration: 1:600. Secondary Antibody: Donkey anti-Rabbit-Cy2/3. Secondary Antibody")
![Western Blot: GlyT2/SLC6A5 Antibody [NBP2-86653] - WB Suggested Anti-SLC6A5 antibody Titration: 1 ug/mL. Sample Type: Human heart](http://images.novusbio.com/fullsize/GlyT2-SLC6A5-Antibody-Western-Blot-NBP2-86653-img0003.jpg "Western Blot: GlyT2/SLC6A5 Antibody [NBP2-86653] - WB Suggested Anti-SLC6A5 antibody Titration: 1 ug/mL. Sample Type: Human heart")
![MGAT1 [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "MGAT1 [Unconjugated]")
![Immunohistochemistry GAD1/GAD67 Antibody [Unconjugated]](https://images.novusbio.com/images2/GAD1_AF2086_Immunohistochemistry_6730.jpg)
![Western Blot GAD1/GAD67 Antibody [Unconjugated]](https://images.novusbio.com/images2/GAD1_AF2086_Western_Blot_19950.jpg)
![Simple Western GAD1/GAD67 Antibody [Unconjugated]](https://images.novusbio.com/images2/GAD1_AF2086_Simple_Western_20168.jpg)
![Western Blot CDC14 Antibody (472508) [Unconjugated]](https://images.novusbio.com/images2/CDC14_MAB4457_Western_Blot_6181.jpg)
![Western Blot CDC14 Antibody (472508) [Unconjugated]](https://images.novusbio.com/images2/CDC14_MAB4457_Western_Blot_23533.jpg)
![Immunohistochemistry GAD2/GAD65 Antibody [Unconjugated]](https://images.novusbio.com/images2/GAD2_AF2247_Immunohistochemistry_20053.jpg)
![Western Blot Collybistin/ARHGEF9 Antibody (809309) [Unconjugated]](https://images.novusbio.com/images2/Collybistin_MAB7848_Western_Blot_12817.jpg)
![Immunohistochemistry Collybistin/ARHGEF9 Antibody (809309) [Unconjugated]](https://images.novusbio.com/images2/Collybistin_MAB7848_Immunohistochemistry_12920.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")